KEGG   Serinus canaria (common canary): 103826646Help
Entry
103826646         CDS       T05755                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00564  Glycerophospholipid metabolism
scan00565  Ether lipid metabolism
scan00590  Arachidonic acid metabolism
scan00591  Linoleic acid metabolism
scan00592  alpha-Linolenic acid metabolism
scan01100  Metabolic pathways
scan04010  MAPK signaling pathway
scan04217  Necroptosis
scan04270  Vascular smooth muscle contraction
scan04370  VEGF signaling pathway
scan04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103826646 (PLA2G4F)
   00565 Ether lipid metabolism
    103826646 (PLA2G4F)
   00590 Arachidonic acid metabolism
    103826646 (PLA2G4F)
   00591 Linoleic acid metabolism
    103826646 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    103826646 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103826646 (PLA2G4F)
   04370 VEGF signaling pathway
    103826646 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103826646 (PLA2G4F)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103826646 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103826646 (PLA2G4F)
Enzymes [BR:scan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103826646 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 103826646
NCBI-ProteinID: XP_009100297
Position
Unknown
AA seq 852 aa AA seqDB search
MFHEVLRGPFPSRALPFLAAVLFQRKERKDTGFYHWRWEKHPYYNLTVKVLRARNIKGTD
VLSKADCYVELKLPTASPRVSRTQVVDNSENPEWNESFQYRIHSAVKNILELTLYDKDVL
VSDELTSVVFDVGGMRPGEPLLHTFSLDAEANEELDVEFFLEKCSDAPTEVLTNGVLVVH
PCLCLQGTVNKEQNAKEKQQGCCEIKVSVPGAYQKQLSIPWTPDNEKDYGTSFVFHVDKE
MCSELQVELQQTISVLQDGVNPDIEKHTTVLGLGTVPVNSLPIGEKVDRIISLGEGKSLD
MSLKTEESTWDLDIRLGFDLCKEEREFLDRRKKVVSEALRKTLCLKESPAKDEVPVVAVL
GSGGGMRALTSFYGSLAGLQQLGLLDAAAYLCGISGSTWCLSTLYRDPDWSQKDLQDAIR
RAQDTVSSSKAGAFSPEQLKYYFQELNAMEMAGRKVSFTDLWGLIVEYFLQQEEDPSKLS
DQQEAVKWAQNPYPIYAAVNVRPNMSSGDFAEWCEFTPYEVGFRKYGAFVRTENFDSEFF
MGRLVQKHPEPRICFLQGMWGSAFAASLDDICLKVVGIGLSFLDSFKDVIKVVDDCHRFH
LRDPARLKTRLVIPGGPLLQIFQDFFMSRVTCGETFNFMKGLYLHKDYVNVKKFVTLRGT
HLDAFPNQLTPMEESLYLVDGGFSINSPFPLVLQPERDVDVILSFNFSWEAPFEVLELTQ
KYCEEREIPFPKIKFSEEDEKKPKECYMFVDDNNPKAPIVLHFPLVNDTFQKYKSPGVER
ESEEEKSFGDFIIESNDSPYRTLNFTFGPNDFSRLVEVTRYNVLNNKDTLLRTLNLALQR
RKLKKVTQKSNT
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgttccatgaggtgctgcggggcccgtttccatccagagcgctgccttttctggcagca
gtgcttttccaaaggaaggagaggaaggacactggcttctatcactggcggtgggaaaag
catccttactacaacctaacagtaaaagtcctccgagccaggaacatcaagggtacagat
gtgttgtccaaggcagactgctatgtggagctaaagctgcccactgcatctcccagggtc
tccagaactcaggttgttgacaactctgagaacccagaatggaatgaaagtttccagtat
cggatccatagcgctgtcaagaacattctggagctgaccctctatgataaggatgtccta
gtcagtgatgagctcacctctgttgtctttgacgtggggggcatgaggccgggggagccc
ctgctgcacaccttcagcctggacgccgaggctaatgaagagctggatgtagagtttttc
ttggaaaaatgctcagatgcccctacagaagtattgaccaacggagtccttgtggttcat
ccttgcttgtgtctgcaaggcactgtcaacaaagagcaaaatgcaaaagaaaagcagcaa
ggatgctgtgagatcaaggtgtctgtcccaggggcataccaaaagcagttgtctattcct
tggacaccagacaatgagaaggattatggaacctcatttgtctttcatgtggataaagaa
atgtgttcagaattgcaagtggagctgcagcaaaccatatctgtcctacaggatggcgtg
aaccctgatattgaaaagcacactacagttctgggactggggactgtaccagttaattcc
cttcctattggagaaaaagttgatagaataatttccttgggagagggaaaaagtttggac
atgagtttgaaaactgaagagagcacttgggatcttgatatacgtctgggttttgatctc
tgtaaagaggagagagaatttttggacagaagaaagaaagtagtttctgaggcactgagg
aagactctttgcttaaaagaatcccctgcaaaagatgaggttccagttgtagcggtgctg
ggctctggaggtgggatgagagccctgacgtccttctatggcagccttgctgggctgcag
cagctgggccttctggatgctgcagcatacctctgtgggatttctggctccacctggtgt
ttatcaaccctgtatcgagaccctgactggtcacagaaggaccttcaagatgcaatcaga
agagctcaggacactgtgtccagcagcaaagcaggggcattttccccagaacagctgaaa
tactatttccaggagctgaatgcaatggagatggcgggacggaaggtttcctttacagat
ttgtggggccttattgtggaatatttcctgcaacaagaggaagatccatcaaagctgtct
gatcagcaggaagcagtgaaatgggcccagaacccttatcctatctatgcagctgtaaat
gtgagacccaatatgagcagtggagactttgcagaatggtgtgagttcactccctatgaa
gttgggtttcgcaaatacggagctttcgttcgaacagagaattttgacagcgagttcttc
atgggacggctcgtccagaaacatccagagcccaggatttgttttctacaaggaatgtgg
ggcagtgcctttgctgcaagcttggatgatatctgtctgaaggtggttggtataggactg
agctttctagattctttcaaagatgttatcaaagttgtagatgactgccacagattccat
ttacgagacccagcacggctgaagactcgcttggttatacctgggggccccttgctacaa
atttttcaggatttcttcatgtcccgggtcacatgtggagaaaccttcaacttcatgaag
ggattgtatcttcataaagattatgttaacgtcaagaaatttgtgactttgagagggact
cacctggatgcgtttcccaaccagctgactcccatggaagagagcttgtatttagtggat
ggtggcttttccatcaactctccctttcctctggtacttcagccagagagggatgtggat
gttatcctgtcgttcaatttttcctgggaagctccatttgaggttctagagctgacccag
aaatactgtgaggagcgggaaattccttttccaaaaatcaaatttagtgaggaagatgaa
aaaaagccaaaagagtgttacatgtttgtggatgataataatccaaaggctccaattgta
ctccatttcccactggtgaatgacaccttccagaaatacaaatctccaggagttgaacgt
gagtcagaagaagagaaatcctttggtgactttatcattgagtcaaacgattccccctac
cgtaccctgaacttcacctttgggccaaatgacttcagcaggctggtggaagtgactcgc
tacaatgtcctgaacaacaaggacactctcctcagaaccctgaacctggctctgcaaagg
aggaagttgaagaaggtcacccagaagtcaaacacctga

DBGET integrated database retrieval system