KEGG   Serinus canaria (common canary): 103826969Help
Entry
103826969         CDS       T05755                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04270  Vascular smooth muscle contraction
scan04350  TGF-beta signaling pathway
scan04510  Focal adhesion
scan04530  Tight junction
scan04810  Regulation of actin cytoskeleton
scan05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103826969 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103826969 (ROCK1)
   04530 Tight junction
    103826969 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103826969 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103826969 (ROCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103826969 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103826969 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:scan03036]
    103826969 (ROCK1)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103826969 (ROCK1)
Protein kinases [BR:scan01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   103826969 (ROCK1)
Chromosome and associated proteins [BR:scan03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103826969 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH Cortex-I_coil FPP Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 103826969
NCBI-ProteinID: XP_009100680
Position
Unknown
AA seq 1358 aa AA seqDB search
MSTGESFESRFEKIDVTLKDPKSEVNVDCLLDGLDALVYDLDFPALRKNKNIDNFLNRYK
DTVNKMRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRRVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDSDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLGVPAENSNDNRTGS
SVDKSVLENMQKMIYELEEQLHNEMQLKDEMEQKCRSSNIKLDKIMKELDEEGNQRKNLE
TAVSQIEKEKMVLQHKINEYQRKFEQENEKRRNVENEVSTLKDQMEDLKKISQHSQISNE
KITQLQKQLEEANDLLRTESDTAARLRKGNTEMSKSLSQVESLNRELQERCRVLESTKLQ
VEKDYYQLQAALESERRDRSHGSEMIGELQVRITALQEEVKNIKNNLERVEAERKQAQDM
LNHSEKEKNNLEIDLNYKLKSLQDRLEQEVNEHKVTKARLTDKHQSIEEARSVAMCEMEK
KIREERAAREKAENRIVQAEKQCSMLDFDLKQSQQKLEHLLQQKERLEDEVRNLTLKLEQ
ETNKRIMAQNELKAQAFESDNLKGSEKQLKQEINTLLEAKRLLEFELAQLAKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIDERNKETQRKMQELQNEKETLATQLDLAETK
AESERLARALAEEQYYELNQESKKAASRHRQELTDKDIIIRRLEETNNTLTKDVDLITKE
NTEISEKFRKQEEDYKMKKEEEISNIRMQYEKSINTERTLKTQAVNKLAEIMNRKDFKID
RKKANMQDLRKKEKENRKLQLELNQEKEKFNQMVVKYQKELNEMQAQLAEESTYRNELQM
QLDSKESDIEQLRRKIVDLQQGMDSTSVASLPTDETDGNLSESRLEGWLSVPNKGNIRRH
GWKKQYVVVSSKKILFYNDEKDKDQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIF
QILYANEGECRKDLEVEPVQPAEKTNFLNHKGHEFIPTLYHFPANCEACAKPLWHVFKPP
AALECRRCHVKCHRDHLDKKEELIAPCKVSYDVTSARDMLLLASCQDEQKKWVTHLVKKI
PKTPPSSFVRASPRTLSTRSSANQSFRKVVKNTSGKTS
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgggagaaagttttgagtctcgctttgagaaaatcgacgtgactttgaaggac
cccaaatccgaagtgaacgtggactgtttgctggatggattagatgctttggtatatgac
ttggattttcctgccttaagaaaaaacaagaacattgataacttcttaaacaggtataaa
gacacagtaaataaaatgagagatctgcgcatgaaagctgaagattatgaagtggtgaag
gtgatcggtagaggggcattcggggaggttcagttggtaaggcataaatcttcaaggaga
gtgtatgctatgaaacttctgagcaaatttgagatgataaaaagatctgattctgccttc
ttctgggaagaaagggatattatggcttttgcaaatagtccctgggttgttcagttattt
tacgcattccaagatgaccgttacctttacatggtgatggaatacatgcctggtggggac
cttgtgaatttaatgagtaactacgatgttccagagaaatgggcaagattttatactgct
gaagttgtacttgcattagatgcaattcactcaatgggttttattcacagagatgtgaag
cctgataatatgctgctagataaagctggtcatttaaaattagcagattttggtacttgt
atgaagatgaacaaggaaggaatggtacgatgtgacacagctgtgggaacaccagactac
atctctcctgaagtattaaagtcccagggaggggatggttactatgggcgggaatgtgac
tggtggtcagttggagtcttcttgtatgagatgcttgtaggtgatacacctttttatgca
gattctttggttggaacgtacagtaagattatgaatcataagaactcccttacttttcct
gacgacagtgacatttctaaagaggcaaaaaacctcatttgtgcctttttaactgatagg
gaagtgaggctaggacgaaatggtgtagaagaaattaaaaggcaccttttcttcaaaaat
gatcaatgggcttgggaaactctcagagacactgtagcaccagttgtgcctgacctaagt
agtgacattgacactagtaattttgatgatctggaagaagacaaaggagaggaagaaaca
tttcccataccaaaagcatttgtgggcaaccagcttccttttgtaggatttacatattac
agcaaccgtcggtatttaggtgtccctgcagaaaattccaatgacaacagaacaggctcc
agtgtggacaaaagtgtgctggaaaatatgcagaagatgatctatgaattagaagaacag
ctacataatgaaatgcagttgaaagatgaaatggaacaaaagtgcagatcttcaaacata
aagctagacaagattatgaaagaactggatgaagagggtaatcaaaggaagaacttggaa
acagcagtgtctcagattgaaaaggaaaagatggtattacaacataagataaatgagtac
caaagaaaatttgaacaagagaatgaaaaaaggcgtaatgtggaaaatgaagtgtccaca
ctaaaagatcagatggaagacttgaaaaaaatcagccagcattcacaaatttcaaatgag
aagataacacagctacaaaaacaactagaagaagcaaatgatttgctgaggacagaatct
gacacagctgcaagactgagaaagggcaacacagaaatgagcaagtcattaagtcaggta
gaatcactgaatagagaactgcaggaaagatgcagagttctggaaagcacaaaactgcag
gtggagaaagattattaccaactacaagcagctttggagtcagaacgaagggatagaagt
catggatctgaaatgattggagaactacaggttcggattacagctttacaagaagaagta
aaaaacattaaaaacaatcttgaaagagtggaagcagaaagaaaacaagcacaggatatg
cttaatcattcagaaaaggaaaagaataatttagagatagatttgaactacaaactgaaa
tccttacaagaccggttagaacaggaagtgaatgagcacaaagtgacaaaagcgcggtta
actgacaaacaccagtcaatagaggaggcaagatcagttgcgatgtgtgaaatggaaaaa
aagataagggaagaacgggcagcaagagaaaaggcagaaaatagaatagttcaagctgaa
aaacaatgttccatgttggactttgacctgaagcaatcccagcagaaactggaacatctt
cttcagcaaaaggagagactggaagatgaagtaaggaatctgacacttaagctagaacaa
gagacgaataaacgaataatggcacagaatgaattaaaggcacaagcttttgaatctgat
aacttgaagggttctgagaagcagttgaaacaggaaatcaataccttgttggaagcaaag
agattactggagtttgagttggctcaacttgcaaaacagtacagaggaaatgaaggtcag
atgcgtgagcttcaggatcagcttgaagctgagcagtatttttcgacactttacaaaact
caggttaaggagctgaaagaggaaattgatgaaaggaataaagaaacacaaagaaaaatg
caggagttacaaaatgaaaaagaaacactcgccacccagttggatttagctgaaaccaaa
gccgagtcggaacggttggcacgggcactcgctgaagagcagtattatgaactgaaccag
gagagtaaaaaagctgcatcaaggcatagacaagaattgactgataaggacatcatcata
agaaggctggaagaaactaataacactttaacgaaagatgttgatttaataacaaaagaa
aatacagaaatcagtgaaaaatttaggaaacaagaagaagattacaaaatgaaaaaagag
gaggaaatcagtaatattagaatgcaatatgagaagagcataaacactgaaagaactctg
aagacacaggctgtcaacaaactggctgagataatgaatcggaaagattttaaaatagac
agaaagaaagctaacatgcaagatttgaggaagaaggagaaggaaaaccgaaagctccaa
ttagaacttaatcaagaaaaagagaaattcaatcagatggttgtgaaataccaaaaggag
ctaaatgaaatgcaagcgcaactagcagaagaatctacatacaggaatgagctccagatg
cagctggatagtaaagagagtgacatagaacaactacgaaggaaaatcgtggacctccag
caaggaatggattctaccagtgttgccagtcttccaacagatgaaacagatggaaatctt
tcagaatcaagacttgaaggttggctttcagtaccaaacaaaggaaatataaggcgtcat
ggctggaagaaacagtatgtggtggtgagcagtaaaaagatactgttctacaatgatgaa
aaagacaaggaccagtctaatccatctatggtactagatatagataagctgtttcatgtc
cggcctgtaactcaaggagatgtatatagagctgaaactgaagaaattcctaaaatattc
cagattctctatgctaatgagggggaatgcaggaaggatttggaggtagaaccagtacag
ccggcagagaagacaaattttctaaatcacaaaggccatgaatttattcccacgttatac
cactttccagccaactgtgaggcctgtgccaaacctctctggcatgtctttaaaccccct
gctgccctagaatgtcgaagatgccatgtgaagtgccacagagaccacttggataaaaag
gaagaattaattgcaccatgcaaagtgagttatgatgtaacttcagcaagagatatgctc
ttgttggcatcctgtcaagatgaacagaagaagtgggtgacacatttagtaaagaagatc
cctaagacaccaccatctagttttgttcgtgcttctcctagaactttgtctacaagatcc
tcagcaaaccagtcattccgaaaagtcgttaaaaatacttctggaaaaaccagctaa

DBGET integrated database retrieval system