KEGG   Serinus canaria (common canary): 103827410Help
Entry
103827410         CDS       T05755                                 

Gene name
SUCLA2
Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00020  Citrate cycle (TCA cycle)
scan00640  Propanoate metabolism
scan01100  Metabolic pathways
scan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103827410 (SUCLA2)
   00640 Propanoate metabolism
    103827410 (SUCLA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scan04147]
    103827410 (SUCLA2)
Enzymes [BR:scan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103827410 (SUCLA2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103827410 (SUCLA2)
Exosome [BR:scan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103827410 (SUCLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 103827410
NCBI-ProteinID: XP_030090685
Position
Unknown
AA seq 463 aa AA seqDB search
MAASMICSRVASGLRGSGLRASLGSTAGKVLAGSPGILSNHGFQVQQQQQRRLSLHEYLS
MGLLKEAGISVPHGVVANTPDEAYKIAKEIGSKDLVVKAQVLAGGRGKGTFEGGLKGGVK
IVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVFICERRYPRREYYFAITMERSFQGP
VLIGSSHGGVNIEDVAAENPEAIIKEPIDIVEGIKKEQAVRLAQKMGFPPNLVDEAAENM
IKLYNLFLKYDATMIEINPMVEDASGVVMCMDAKINFDSNSAYRQKKIFDMQDWTQEDQR
DKDAAKADLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATAQQVTEA
FKLITSDKKVLAILVNIFGGIMRCDVIAQGIVTAVKDLELKVPIVVRLQGTRVDDAKALI
TASGLKILACDDLDEAAKMVVKLSEIVSLAKQAHVDVKFQLPI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccatgatctgcagccgggtggcgtccgggctgaggggcagcggcctccgc
gcctcgctgggttccaccgcggggaaggtgcttgctggaagtccaggaatactcagcaat
catgggtttcaagtgcagcaacagcaacagaggaggctgtcactccatgaatacctgagc
atgggactgttgaaggaggctggcatttctgttccacatggagtggttgccaatacgcca
gatgaagcttacaaaatagcaaaagaaataggttcaaaggatcttgtggtaaaagcacag
gtcttagctggtggtagaggaaaaggaacatttgaaggtggcctcaaaggaggagtgaaa
atagttttttctccagaagaggcaaaagctgtctcctcccaaatgattggaaagaagttg
tttaccaagcagacaggagagaagggcaggatatgcaatcaagtatttatctgtgaacgc
agatatcccaggagagaatactattttgcaataacaatggaaaggtcttttcaaggtcct
gtgctgataggcagttctcacggtggtgtcaatattgaagatgttgctgcagagaatcct
gaggcgataattaaggaacccatcgatatagtagaaggcataaaaaaggaacaagctgtt
aggcttgcccagaaaatgggatttcctcctaatctggtggatgaagcagctgaaaatatg
atcaaattatataatctctttctgaaatatgatgctaccatgatagaaataaatcctatg
gtggaagatgcatcaggagttgtgatgtgtatggatgcaaagataaactttgacagcaat
tcagcctatcgtcagaagaagatctttgatatgcaggattggacacaggaagaccaaaga
gacaaggatgctgcaaaagcagatctcaactatatagggttggatggaaacataggatgc
ttagtcaatggtgctggtttagctatggccacaatggatataattaaacttcacggcgga
actccagcaaacttccttgatgttggtggtggtgctacagcgcagcaagtgacagaagcc
tttaagcttattacctctgataaaaaggtactggctattctggtaaatatttttggtggc
attatgaggtgtgatgtcatagcacaaggcatcgttacggcagtaaaggatttggagcta
aaagttcctattgtggtacggttgcaaggtacacgagttgatgatgccaaagctttaata
acagctagtggcctcaaaatcctcgcatgtgatgacttggatgaagctgcaaaaatggtg
gtgaagctgtctgaaatagtaagcttagcaaaacaagctcatgtggacgttaaatttcag
ttgccaatttga

DBGET integrated database retrieval system