KEGG   Serinus canaria (common canary): 115484818
Entry
115484818         CDS       T05755                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:scan03000]
    115484818 (AHRR)
Transcription factors [BR:scan03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    115484818 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 Herpes_U5 PAS_4 DUF1505
Other DBs
NCBI-GeneID: 115484818
NCBI-ProteinID: XP_030089823
Position
Unknown
AA seq 760 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQAGQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVRAKHKADDAAAAANT
NSSSKGSSGLCEATELYGRNNHHEGAAFTNALQIAENQIKAKNNGENGISLVKVQTNEDH
WVWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKILSGFASLKGNLEGLSYNSAIETLG
QWKHLNWAAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNSSWTLRNS
SSCSMSQRMNTCPNRRAGSFYNRDQNFLNLAPTCPSHWGSAENSQSYSGLQQRCAENYAT
DHGKLQRPFLSPEPLYDTAPPLEMPIKTEYDSDSENIADNYLLPQSRAWLDESGSLRKQG
PGYPGRVHLKTEPDLCQPALPCQKPRHCLYTPHNWQCIVANHPNSLNLNRAGKGARNKEV
APFCPQNSSVCLESMPDLPHTACYGHFYSPSPGEEKEQINEVFKMPCEFKNPCLVQAIKR
EPLDSPPLSSSGQNRVHPSFPENTLAGPVPHKTTECTFLQ
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctgtatgctgggaggaaaaggaggaaacccattcaaaaa
caaaggcccgcagttgggaacgaaaaatccaatccttcgaagagacacagagaccgtctg
aatgcggaactggaccacctggccagcctcctgcctttcccccctgacatcgtatccaag
ctggacaaactttccgtcctgcgcctcagtgtcagctatctccgagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagctggccaaacgataaaagaagacaat
atatctaacaagactgctgtacaagaaggtggacttctactagaatcactgaatggtttt
gccttggtggtgagtgcagatggaatgatattctatgcatcatcgacaattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacatccacgtggat
gaccgccaggatttctgcagacaattgcactgggccatgaatcccccccagatgttgtcg
ggacagcaactacagtcagaaacaggagaagaatatattctcagtaaattgttcaaagcg
caagagaatgacagcatgacaacagattattcttcctttttaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggattccttacaatgcagttccaaggcaaa
ctaaagttcctctttggacaaaggaagaagtcctcatcaggaacagtactgccacctcag
ctgtccttattctgcatagtggtgccacttctgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgagagcaaaacacaaagctgacgatgcagcagcagcagcaaacacg
aactccagttcaaaaggcagctcaggactttgtgaagccacagaattgtatggaagaaac
aatcaccatgaaggtgctgccttcactaatgcattacagattgctgaaaaccaaatcaaa
gcaaagaataatggagaaaatggcatttctctagtcaaagtacaaacaaatgaagatcac
tgggtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgtc
cttgcccaacaacaaatgttgaaggaagaagatgaacaactgaagatactaagtggtttt
gccagtttgaaaggaaacctggaggggctttcctataacagtgccattgaaactctgggc
cagtggaagcatcttaactgggcagcagtgaagaatgaacaagataatgtaaaagtgaag
tttgagcctcacactaatggtgagtgttttatgcaagaggaacctctcagctctaataca
tcagttttaggcattcaaaacaactgcaccacaaacagtagctggactttaagaaactcc
agttcttgttctatgagccagagaatgaacacgtgtccaaacaggagagctggatcattc
tacaacagagaccaaaatttcttaaatttggcaccaacttgtccttcccactgggggagc
gccgaaaacagccagtcctactcggggctccaacagcgctgtgcagagaactacgccaca
gaccacgggaagctgcagagaccattcctatccccagagcctctctatgacacagcccct
cccttggagatgcctatcaaaacggagtacgactctgactctgaaaacattgccgataac
tacctgctcccgcagagccgagcctggctggatgagagcggctcgctgagaaagcagggg
cctggctaccctggcagagtgcacctcaaaacggagccagacctctgccagccagccttg
ccttgccagaagccaaggcactgcctttacacaccccataactggcaatgcatcgtagca
aatcatcccaacagcctgaacttgaacagggctggcaagggcgcacggaacaaggaggtg
gctcccttttgccctcagaactcctccgtgtgtttggaaagcatgcctgacctgccacac
accgcttgctacggccacttctacagccccagcccaggagaggagaaagagcagattaat
gaggtgttcaaaatgccatgtgaatttaaaaacccctgcttggttcaagcaatcaagcgg
gagcccctggattctccacccttgtccagcagtggacagaacagagtacacccaagcttc
cctgaaaatacattagcaggtcctgtgcctcataaaaccactgaatgtacatttttgcaa
tag

DBGET integrated database retrieval system