KEGG   Staphylococcus capitis: AYP1020_1631Help
Entry
AYP1020_1631      CDS       T03970                                 

Gene name
gutB
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
scap  Staphylococcus capitis
Pathway
scap00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:scap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AYP1020_1631 (gutB)
Enzymes [BR:scap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AYP1020_1631 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AYP1020_1631 (gutB)
    1.1.1.-  
     AYP1020_1631 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N Lyase_1
Motif
Other DBs
NCBI-ProteinID: AKL92722
UniProt: A0A341EW18
Position
1647794..1648846
Genome map
AA seq 350 aa AA seqDB search
MKAAVWYGQKDVRVEDRDPKVLKDDEVQVKVSWTGICGTDLHEYLEGPIFISTDKPDPLL
GQKAPVTLGHEFSGVVENVGKDVTRFKKGDRVVVNPTVSKREKEENVDLYDGYSFIGLGS
DGGFAEFTNAPETNVYHLPDNVSAREGALVEPTAVAVQAVKEGELLFGDTVAVFGAGPIG
LLTVIAAKAAGASKIFVFDLSEERLEKARSVGATHTFNSGNVDPVKAVYDNTENGVDVSF
EVAGVGITLQQSIEVTRPRGTSVIVAIFGHPVEFNPLLQMNRGVKLTTTIAYTPTTFQQT
IDLIANGSLNVKDVVTDEIELENIVESGFNQLVNDKSQAKILVRLNGDQK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtctggtatggacaaaaagatgttcgtgtagaggaccgcgatccaaaa
gtattaaaagatgatgaagttcaagtgaaagtctcatggacaggtatttgtggtacagat
ttacatgaatatttagaaggacctattttcatttcaacagacaaacctgatccgttgtta
ggtcaaaaagcacctgtaacattgggtcatgagttttctggcgtagttgaaaacgttggt
aaagatgttacacgtttcaaaaaaggtgaccgagttgtcgtaaacccaactgtttctaaa
cgtgaaaaagaagaaaatgttgatttatatgatggttattcatttataggtttaggttca
gatggagggtttgcagagtttactaacgcacctgaaacaaacgtgtatcatttacctgac
aatgtatcagcacgtgaaggcgcacttgttgaacctacagctgtagctgttcaagctgtt
aaggaaggcgaattattattcggtgacacagttgcggtatttggagctggacctattggt
ttactaactgttatagcagctaaagcagctggtgcaagtaaaatctttgtcttcgatcta
tctgaagaacgtttagaaaaagcaagaagcgttggagcaactcatacctttaactctgga
aatgtagacccagtaaaagctgtatatgataacactgaaaatggtgtagatgtttcattc
gaagtagctggtgttggtattacattacaacaatctattgaagtgacacgtccacgtggt
acttcagttatcgtagctattttcggtcatccagtagaatttaatcctcttcttcaaatg
aatagaggggttaaattaactactacaattgcctatacaccaacaactttccaacaaaca
atcgatttaatcgctaatggtagtttaaatgttaaagatgtagttactgatgaaattgaa
ttagaaaatatagtcgaaagtggtttcaatcaacttgttaatgataaatcgcaagctaaa
attttagtccgtttaaatggtgatcaaaaataa

DBGET integrated database retrieval system