KEGG   Staphylococcus capitis: AYP1020_2109Help
Entry
AYP1020_2109      CDS       T03970                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scap  Staphylococcus capitis
Pathway
scap00071  Fatty acid degradation
scap00072  Synthesis and degradation of ketone bodies
scap00280  Valine, leucine and isoleucine degradation
scap00310  Lysine degradation
scap00362  Benzoate degradation
scap00380  Tryptophan metabolism
scap00620  Pyruvate metabolism
scap00630  Glyoxylate and dicarboxylate metabolism
scap00640  Propanoate metabolism
scap00650  Butanoate metabolism
scap00900  Terpenoid backbone biosynthesis
scap01100  Metabolic pathways
scap01110  Biosynthesis of secondary metabolites
scap01120  Microbial metabolism in diverse environments
scap01130  Biosynthesis of antibiotics
scap01200  Carbon metabolism
scap01212  Fatty acid metabolism
scap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYP1020_2109
   00630 Glyoxylate and dicarboxylate metabolism
    AYP1020_2109
   00640 Propanoate metabolism
    AYP1020_2109
   00650 Butanoate metabolism
    AYP1020_2109
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYP1020_2109
   00072 Synthesis and degradation of ketone bodies
    AYP1020_2109
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYP1020_2109
   00310 Lysine degradation
    AYP1020_2109
   00380 Tryptophan metabolism
    AYP1020_2109
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYP1020_2109
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYP1020_2109
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYP1020_2109
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scap04147]
    AYP1020_2109
Enzymes [BR:scap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYP1020_2109
Exosome [BR:scap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYP1020_2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin DUF2268
Motif
Other DBs
NCBI-ProteinID: AKL93197
Position
2175738..2176925
Genome map
AA seq 395 aa AA seqDB search
MTRVVLAEAYRTPIGVFGGAFKDVPAYDLGATVIKHIVKNTGIDSNEINEVIMGNVLQAG
QGQNPARIASIKGGLSEATPAFTLNKVCGSGLKAIQLAYQSIVAGDNEVVIAGGMESMSQ
SPMLLKNGRFGFKMGNQTLEDSMVSDGLTDKFNDYHMGITAENLVEKYGISREEQDQFAA
QSQQKAAHAQETGGFNAEIVPVEVPQRKGDPIVVSQDEGIRQGTTADKLGKLRPAFKKDG
SVTAGNASGINDGAAAMLVMTEEKAKALGVKPIAILDSFGTSGVDPSIMGIGPVEAVRQA
LKRSNKSVSDIDVFELNEAFASQSLAVDRELQLPQDKVNVKGGAIALGHPIGASGARILV
TLLHQLNETTKTGIASLCIGGGQGIATVVSHYEEG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacacgagtagtactagcagaagcatatcgtacacctattggcgtatttggaggcgca
ttcaaagatgtacctgcatatgatttaggtgcaacagtcatcaagcacatcgttaaaaat
acaggtatagattcaaatgaaatcaatgaagtgattatgggcaatgtcttacaagcaggc
caaggacaaaaccctgcacgtattgcttctattaaaggaggattatctgaagctacgccg
gcatttacattgaataaagtatgtggttctggattgaaagcaattcaacttgcatatcaa
tctatcgtagcaggtgataatgaggtcgttattgcaggtggcatggagagtatgtcgcaa
tcaccaatgttattaaaaaatggtcgctttggctttaaaatgggcaatcaaacattagaa
gatagtatggtaagtgatggtttaacggataaattcaacgattaccacatgggaattact
gcggagaatttagttgaaaaatatggaatcagtagagaggaacaagaccaattcgcagct
caatctcaacaaaaggcggcgcatgcacaagagactggtgggtttaacgctgaaattgtg
ccggttgaggtacctcagcgtaaaggtgatcctatcgttgtttcacaagatgaaggtatt
cgccaaggcacaacagcagataagttaggcaagttacgtcctgcctttaaaaaggatggt
tcagtaacagctggtaatgcgtccggtattaacgatggtgcggctgcgatgttagtgatg
actgaagagaaagcaaaagccttaggtgttaagccgattgcaattcttgatagtttcggc
acgagtggcgtggatccatcaatcatggggattggtcctgttgaagcggttcgtcaagca
ttgaagcgctcgaataaatcagtttcagatattgatgttttcgaattaaatgaagccttt
gcctctcaatcattggcagttgatcgcgaacttcaactaccacaagataaagtaaatgtg
aaaggtggcgcaattgcgctaggtcatcctatcggtgcatcaggtgcgcgtatacttgta
acgttattacatcaattgaacgaaaccacaaaaacgggtatcgcttcattatgtattggt
ggaggacaaggtatcgctactgttgtctctcactatgaggagggataa

DBGET integrated database retrieval system