KEGG   Staphylococcus capitis: AYP1020_2323Help
Entry
AYP1020_2323      CDS       T03970                                 

Gene name
yhfS
Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase YhfS
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scap  Staphylococcus capitis
Pathway
scap00071  Fatty acid degradation
scap00072  Synthesis and degradation of ketone bodies
scap00280  Valine, leucine and isoleucine degradation
scap00310  Lysine degradation
scap00362  Benzoate degradation
scap00380  Tryptophan metabolism
scap00620  Pyruvate metabolism
scap00630  Glyoxylate and dicarboxylate metabolism
scap00640  Propanoate metabolism
scap00650  Butanoate metabolism
scap00900  Terpenoid backbone biosynthesis
scap01100  Metabolic pathways
scap01110  Biosynthesis of secondary metabolites
scap01120  Microbial metabolism in diverse environments
scap01130  Biosynthesis of antibiotics
scap01200  Carbon metabolism
scap01212  Fatty acid metabolism
scap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYP1020_2323 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    AYP1020_2323 (yhfS)
   00640 Propanoate metabolism
    AYP1020_2323 (yhfS)
   00650 Butanoate metabolism
    AYP1020_2323 (yhfS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYP1020_2323 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    AYP1020_2323 (yhfS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYP1020_2323 (yhfS)
   00310 Lysine degradation
    AYP1020_2323 (yhfS)
   00380 Tryptophan metabolism
    AYP1020_2323 (yhfS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYP1020_2323 (yhfS)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYP1020_2323 (yhfS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYP1020_2323 (yhfS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scap04147]
    AYP1020_2323 (yhfS)
Enzymes [BR:scap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYP1020_2323 (yhfS)
Exosome [BR:scap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYP1020_2323 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKL93391
Position
2384798..2385934
Genome map
AA seq 378 aa AA seqDB search
MKQPVIVAAKRIAFGKYGGYLKHLEPEQLLKPLFNYFQAEYPGAMEYLEDVIIGNTVGNG
GNIARKSLLEAGLKNSVPGVTIDRQCGSGLETIIQACRMIQSGAGNVYLAGGVESISRAP
WKLKRPQSVYETEFPQFFERAPFAPEGQDPSMIEAAENVARKYGISRVMQDKFAYRSHQL
TQGNYDNGNISREILPIKVKGVSFDRDESVKSRLTTEKLSRFKPLLNQGSITVGNSCMKN
DGAVLILVMEEKLAINLGFAKGLKFIESCTVGVDPNYLGIGPVPAVRKLLKRAKVKIEDI
DTIELNEAFSSQVLACQKELSISDDKLNRWGGAIASGHPYGASGAALVTRLFHMNVQNKS
IATMGIGGGLGNAVLFER
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaccagtcattgtagcagctaaacgaattgcatttggcaagtacggtggatat
ttaaagcatttggaaccagaacaactactaaaacctttattcaattactttcaagcagaa
tatcctggagcgatggaatacttggaagacgttattatcggcaacacagttggcaatggt
ggtaacatcgcaaggaaatctttgctagaagcaggccttaaaaactccgttccaggcgtt
actattgatcgacagtgtggttcagggctagaaactattatacaagcttgtagaatgata
caaagtggcgctggaaatgtataccttgcaggtggtgttgagagtataagtagagcacct
tggaaattaaaacgacctcaatcagtgtatgaaacagaatttcctcaattcttcgaaaga
gcgccatttgctccagaaggtcaagatccttcaatgatagaagctgctgaaaatgtggcg
cgtaaatacggtatttcgcgagtaatgcaagataagttcgcttatagaagccatcaattg
actcaaggtaactatgataatgggaatatttcccgagaaatattgcctattaaagttaaa
ggggtatcgtttgatagagatgaaagtgttaagtctcgtttaactactgagaaattaagt
agatttaaaccattattaaatcaaggttcaattacagttggtaacagttgtatgaaaaat
gatggtgccgtattaatccttgtaatggaagagaaactcgctataaacttaggttttgct
aaaggattaaaatttattgaaagttgtacagttggggttgatcctaattatttaggtata
ggtcctgtgccagcagttagaaagctgttgaaaagagctaaagttaaaatagaagatatt
gatactatagaattaaatgaagcatttagttcacaggttttagcttgtcagaaggaactt
agtatttctgatgataagctaaatcgatggggtggcgcaatcgcttctggtcacccatat
ggagcaagtggcgctgctctagttacacgattatttcatatgaatgtgcaaaataaatcc
attgcaacaatgggaatcggtggaggactcggtaatgcagtattatttgagagatag

DBGET integrated database retrieval system