KEGG   Streptomyces scabiei: SCAB_12861Help
Entry
SCAB_12861        CDS       T01187                                 

Gene name
aga
Definition
(GenBank) putative alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
scb  Streptomyces scabiei
Pathway
scb00052  Galactose metabolism
scb00561  Glycerolipid metabolism
scb00600  Sphingolipid metabolism
scb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCAB_12861 (aga)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCAB_12861 (aga)
   00600 Sphingolipid metabolism
    SCAB_12861 (aga)
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SCAB_12861 (aga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: CBG68445
UniProt: C9Z6Q4
Position
complement(1442818..1444893)
Genome map
AA seq 691 aa AA seqDB search
MLEIGADGRTWILTGPRSSYALRLTDDGELLHLHWGPRIALADAEELAARQRLPYWPFEA
PVDGHEEYPVEGGPRFTRPALSVRTDERRGTEWTFREYEADGDELRLRFADGGLGITLHY
RLRDDVIERWVTLVNDGPAVELLRADSATWTLPTRAEETWRLSQLHGRWAAESRLVRADL
TYGEKVIGSRRGHTGHQHLPWVALDTDATEEHGEVYGCALGWSGSWRIAVAQLPDARVQI
TGGAGYDESGLLRLETGETFTTPVFAGLWSDGGHGGASRAWHAYQRTYVIPHADQDRPVL
FNSWEATEFDISEEQQGALARRAAAIGVELFVVDDGWFGARTSDRAGLGDWTPNPDRFPQ
GLKPLADEVHALGMQFGIWVEPEMVNPDSELYRAHPDWAQFQTGRKRTELRNQLVLNLAR
EDVQEYLWEKLDTLLSSAPIDYVKWDFNRCFTDAGWPGEPYPQKLWVEHVHAYYALLDRL
RAAHPGVAFESCSGGGGRIDLGVMARTDQVWTSDNTDPLDRLAIQHGFSQIHPARTMAAW
VTDSPNNQLNGRVSSLRFRFVSAMAGVLGVGGDLTEWTEEELAEAGEWVELYKQIRPVVQ
RGDLYRLRPPTGGLSAVQYVHGDEVVVLACLQAQHYGEPPAPLRLRGLDPAEAYECRETG
EVHRGAVLVHHGLSTGLRGDFDAKVIRLRRI
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaatcggcgcagacggccggacctggattctcaccgggcccaggagcagctat
gccctgcggctcacggacgacggcgaactcctgcacctgcactggggcccgcggatcgcg
ctggccgacgccgaggagctggccgcccggcagcggttgccgtactggccgttcgaggcc
ccggtcgacggacacgaggagtaccccgtcgagggcggcccccgcttcacccggcccgcc
ctgtccgtgcgcacggacgagcggcgcggcaccgagtggaccttccgggagtacgaggcc
gacggtgacgagctgcggctgcggttcgccgacggcgggctcgggatcacgctgcactac
cggctgcgcgacgacgtgatcgagcgctgggtgaccctggtcaacgacgggccggcggtg
gaactgctgcgggccgactcggcgacctggacgctgccgacccgcgcggaggagacctgg
cggctgtcccagctgcacggacggtgggcggccgagtcccggctcgtgcgcgccgacctc
acctacggggagaaggtcatcggcagccggcgcggccacaccgggcaccagcacctgccc
tgggtcgccctggacaccgacgccaccgaggagcacggcgaggtctacggctgcgccctc
ggctggtcggggtcctggcggatcgcggtcgcccagctgccggacgcgcgggtgcagatc
accggtggcgccgggtacgacgagtccggtctgctccggctggagacgggcgagacgttc
accacgcccgtcttcgccggactgtggagcgacggcggccacggcggcgcgagccgcgcc
tggcacgcgtaccagcggacgtacgtcatcccgcacgcggaccaggaccggccggtgctc
ttcaactcctgggaggccaccgagttcgacatctccgaggagcagcagggcgcgctcgcg
cggcgtgcggcggccatcggggtcgagctgttcgtcgtggacgacggctggttcggggcg
cggacgagcgaccgggccggcctcggcgactggacgcccaatccggaccgcttcccgcag
ggtctcaagcccctggccgacgaagtgcacgccctcggtatgcagttcggtatctgggtc
gagcccgaaatggtcaacccggacagcgagctgtaccgggcgcatcccgattgggctcag
ttccaaacgggtcgaaagaggacggagctgcgcaatcagctcgtcctcaacctcgcgcgc
gaggacgtccaggaatacctctgggagaaactggacacgctgctgtccagtgcgccgatc
gactatgtgaagtgggacttcaaccgctgcttcacggatgccggctggcccggcgagccg
tatccgcagaagctgtgggtcgaacacgtgcacgcctactacgccctgctggaccggctg
cgggccgcgcacccgggggtggccttcgagtcgtgctccggaggcggcggccgcatcgac
ctcggggtgatggcccggaccgaccaggtctggacgtcggacaacaccgacccgctcgac
cggctcgccatccagcacggcttcagccagatccacccggcccggaccatggccgcatgg
gtcaccgacagcccgaacaaccagctcaacggccgcgtcagctccctgcggttccgcttc
gtcagtgccatggcgggtgtgctcggggtcggcggcgacctcaccgagtggacggaggag
gagctggccgaggcgggggagtgggtcgagctgtacaagcagatccggcccgtcgtgcag
cgcggtgatctgtaccggctgcggccgccgacgggtgggctaagtgccgtgcagtacgtc
cacggtgacgaggtggtggtcctggcgtgcctccaggcccagcactacggcgagccgccg
gccccgctccggctgcgcggcctggacccggcagaagcatacgagtgccgcgaaacgggc
gaagtccaccgaggggccgtgctggtgcaccacgggctgtcgacgggcctgcgtggcgac
ttcgatgcgaaggttatccgcttgcgtcgcatctga

DBGET integrated database retrieval system