KEGG   Streptomyces scabiei: SCAB_16761Help
Entry
SCAB_16761        CDS       T01187                                 

Definition
(GenBank) ABC transporter integral membrane protein
  KO
K10440  ribose transport system permease protein
Organism
scb  Streptomyces scabiei
Pathway
scb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:scb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SCAB_16761
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scb02000]
    SCAB_16761
Transporters [BR:scb02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    SCAB_16761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: CBG68810
UniProt: C9ZD82
Position
complement(1887169..1888173)
Genome map
AA seq 334 aa AA seqDB search
MSPPRDADKAAPADAPPAWRARVFRADVRTLSLLGVLAALILIGGLTRPDEFLDTRNLQL
VLTQASVIGVVTVGMTFVITSGGIDLSVGAIVALASVWATTVATQEYGFAGILFTAMIVG
VGCGLVNGLLIAYGGMVPFIATLAMLASARGLALQITDGSTQVVTVGSVLDLGERDAYVL
GVPPLVLVFAVVTIIGWLVLNRTTFGRRTVAVGGNPEAARLAGIDVRRQRLYLYLLSGLC
CGIAAFLLIVLAGSGQNTNGNLYELDAIAAAIIGGTLLTGGRGTITGSVLGVLIFTTITN
IFALNNLQSDVQQIAKGAIIVAAVLVQRRTASTT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaccccgggacgccgacaaggccgcacccgccgacgcgccgcccgcctggcgg
gcccgagtcttccgcgccgacgtccgcaccctctcgctcctcggcgtgctcgccgcgctg
atcctcatcggcggactcacccggcccgacgagttcctcgacacccgcaacctccaactc
gtgctcacccaggcctcggtgatcggtgtcgtcaccgtcggcatgaccttcgtcatcacc
tccggcggcatcgacctgtcagtcggcgcgatcgtcgccctggcgtccgtctgggcgacg
accgtggccacccaggagtacgggttcgccggcatcctcttcacggcgatgatcgtcggc
gtcggctgcggactggtgaacgggctgctcatcgcctacggcggcatggtccccttcatc
gccaccctcgccatgctcgcctcggcccgcggactggccctgcagatcaccgacggcagc
acccaggtcgtcaccgtcggctccgtcctggacctcggcgaacgcgacgcctacgtcctc
ggcgtcccgccgctcgtcctggtcttcgcggtcgtgacgatcatcggctggctggtgctg
aaccgcaccaccttcggccggcgcaccgtcgccgtgggcggcaacccggaggcggcccgg
ctcgcgggcatcgacgtccgccgccagcggctgtatctgtacctgctctccggactgtgc
tgcggcatcgccgcgttcctgctgatcgtgctggccggctcgggccagaacaccaacggc
aacctctacgaactcgacgccatcgccgccgcgatcatcggcggaaccctgctcaccggc
ggccggggcaccatcaccggctccgtcctcggcgtcctgatcttcaccacgatcaccaac
atcttcgcgctcaacaacctgcagagcgacgtccagcagatcgccaagggcgcgatcatc
gtcgccgcggtcctggtccagagacgtacggcaagcacgacctga

DBGET integrated database retrieval system