KEGG   Streptomyces scabiei: SCAB_17671Help
Entry
SCAB_17671        CDS       T01187                                 

Definition
(GenBank) putative decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
scb  Streptomyces scabiei
Pathway
scb00564  Glycerophospholipid metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
Module
scb_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:scb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCAB_17671
Enzymes [BR:scb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     SCAB_17671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CBG68897
UniProt: C9ZEW4
Position
1991251..1991763
Genome map
AA seq 170 aa AA seqDB search
MAVPATALAAGMLWFFRDPEREIAQGRVISPADGVVQSIMPWKDGRTRVAIFMSPLNVHV
NRAPLSGTVTSVEHIPGGFVPAFNKESENNERVVWHFDTELGDIEMIQIAGAVARRIVPY
IPEGTKVEQGDRIGLIRFGSRVDIYLPEGVEIDVEVGQKTVAGVTRIDRD
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtacccgccaccgcgctggcggcgggcatgctgtggttcttccgcgaccccgag
cgtgagatcgcccagggccgggtcatctcgcccgccgacggagtggtgcagagcatcatg
ccgtggaaggacggccgcacccgcgtcgcgatcttcatgagcccgctcaacgtccacgtc
aaccgggcgccgctgtccggcacggtgacgtcggtcgagcacatcccgggcgggttcgtg
ccggcgttcaacaaggagagcgagaacaacgagcgcgtcgtctggcacttcgacaccgaa
ctcggtgacatcgagatgatccagatcgccggagccgtggctcgccgtatcgtcccgtac
atccccgagggcaccaaggtcgagcagggtgaccggatcgggctgatccgcttcggctcg
cgggtggacatctacctgcccgagggtgtggagatcgacgtcgaggtggggcagaagacc
gtggctggagtgactcgcattgaccgtgactga

DBGET integrated database retrieval system