KEGG   Streptomyces scabiei: SCAB_2081Help
Entry
SCAB_2081         CDS       T01187                                 

Gene name
bphG
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
scb  Streptomyces scabiei
Pathway
scb00360  Phenylalanine metabolism
scb00362  Benzoate degradation
scb00620  Pyruvate metabolism
scb00621  Dioxin degradation
scb00622  Xylene degradation
scb00650  Butanoate metabolism
scb01100  Metabolic pathways
scb01120  Microbial metabolism in diverse environments
scb01220  Degradation of aromatic compounds
Module
scb_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCAB_2081 (bphG)
   00650 Butanoate metabolism
    SCAB_2081 (bphG)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SCAB_2081 (bphG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCAB_2081 (bphG)
   00622 Xylene degradation
    SCAB_2081 (bphG)
   00621 Dioxin degradation
    SCAB_2081 (bphG)
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SCAB_2081 (bphG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CBG67426
UniProt: C9ZEG7
Position
complement(229538..230473)
Genome map
AA seq 311 aa AA seqDB search
MAVIGSGNIGTDLMIKILRLSDTLEMSAMVGIDPDSDGLARAARLKIATTHQGVEGLIAL
PGFEDIGIVFDATSAKAHIANAARLAPYGKRLIDLTPAAIGPFVVPPVNGDAQPDAMNVN
MVTCGGQATIPVVGAVSAVTPVHYAEIVASIASRSAGPGTRANIDEFTETTSRAIESVGG
AARGKAIIVLNPAEPPLIMRDTVFCLIGDADHEAVRASVETMVGRVAQYVPGYRLKQQVQ
FIPVDGTEPVHTLVPPGAGPVRTRVSVFLEVEGAAHYLPAYAGNLDIMTSAALRVAESIA
RRDAVPPEGRP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcatcggatccggcaacatcggcaccgacctgatgatcaagatcctgcgtctg
tcggacacgctggagatgagtgccatggtcggcatcgacccggactccgacgggctcgcc
cgtgccgcccgcctgaagattgccaccacccaccagggtgtcgaagggctgatcgcgctc
cccggtttcgaggacatcggcatcgtcttcgacgcgacctcggccaaggcccacatcgcc
aacgcagcccggctggcgccgtacgggaagcggctcatcgacctcacccccgccgcgatc
ggcccgttcgtcgtaccgccggtcaacggggacgcccaaccggacgccatgaacgtgaac
atggtgacgtgcggcggccaggcgaccatccccgtggtcggggcggtctcggcggtgacc
ccggtccactacgcggagatcgtcgcctccatcgcctccaggtcggcggggccgggcacg
cgggccaacatcgacgagttcaccgagaccacctcccgcgccatcgagtccgtcggcggc
gccgcccggggcaaggcgatcatcgtcctcaacccggcggagcccccgctcatcatgcgg
gacacggtgttctgcctcatcggggacgccgaccacgaggccgtacgcgcgtcggtcgag
accatggtcggccgtgtcgcccagtacgtccccggctaccgcctcaagcagcaggtgcag
ttcatcccggtggacggcaccgaaccggtgcacaccctggtgccgccgggcgcgggtccg
gtgcgcacccgggtgtcggtcttcctcgaagtcgagggcgccgcccactacttgcccgcc
tacgccggaaacctcgacatcatgacgtcggccgccctgcgggtcgccgagtcgatcgcc
cggcgcgacgccgttcccccggagggccgcccatga

DBGET integrated database retrieval system