KEGG   Streptomyces scabiei: SCAB_36891Help
Entry
SCAB_36891        CDS       T01187                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
scb  Streptomyces scabiei
Pathway
scb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:scb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SCAB_36891 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:scb03011]
    SCAB_36891 (rplV)
Ribosome [BR:scb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SCAB_36891 (rplV)
  Bacteria
    SCAB_36891 (rplV)
  Archaea
    SCAB_36891 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CBG70777
UniProt: C9YW73
Position
complement(4156451..4156798)
Genome map
AA seq 115 aa AA seqDB search
MEARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAH
NYDHTDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVSSKEGTR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggcccaggcgcggtacatccgcgtcacgcccatgaaggcccgccgcgtg
gtggacctcatccgtggcatggatgccacggaggctcaggcggtcctgcgtttcgccccg
caggccgcgagcgtgccggtcggcaaggtgctggacagcgccattgccaacgccgcacac
aactacgaccacacggacgcctcttcgctggtcatcagcgaggcgtacgtggatgagggc
ccgaccctgaagcggttccgtccgcgtgcccagggccgtgcctaccggatccgcaagcgg
accagccacatcaccgtggtcgtcagcagcaaggaaggaacccggtaa

DBGET integrated database retrieval system