KEGG   Streptomyces scabiei: SCAB_58271Help
Entry
SCAB_58271        CDS       T01187                                 

Definition
(GenBank) putative sugar hydrolase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scb  Streptomyces scabiei
Pathway
scb00520  Amino sugar and nucleotide sugar metabolism
scb01100  Metabolic pathways
scb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:scb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCAB_58271
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SCAB_58271
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCAB_58271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: CBG72850
UniProt: C9Z4A0
Position
complement(6489417..6491219)
Genome map
AA seq 600 aa AA seqDB search
MPSRRTLLAATAGVTTALTLGTDAQAVSGPDDKRLRRLISRMTLEEKVGQLFVMRVYGHS
ATAPDQADIDANLQELGVRTAAELLAKYRVGGIIYFSWAHNTRDPHQIAALGNGIQRASL
ALPRGLPVLVSTDQEHGAVARVGRPATLLPGAMALGAGGSGTDAREAGRISGAELRALGV
RQDYAPVADVNVNPANPVIGVRSFGADPKAVSKLVAAQVKGYQEAGVAATAKHFPGHGDT
AVDSHYGFPVIEHTRKQWTALDAPPFKAAIRAGIDSIMTAHIMVPALDPSGDPATLSRPI
ITGILRGELGYDGVVVTDSLGMQGVREKYGDDRVPVLALKAGVDQLLNPPSIDVAWNAVL
DAVHAGELTEARLDRSLLRILRLKAKLGLFERPYVSDAGVDRVVGIARHLDAADRIAERT
TTLLVNKGGLLPLNRTGQRKVLVVGADPASPTGTTGPPTAVLAAELTSLGFTTTRLPTGT
APTQAAIDQAVAAAAGQDVVVVATYNVTATGTQKTLVARLIATGVPVVAVAVRNPYDVAH
LPGVKGCVAAYSWTDVEVRAAARVLAGRVAPRGKLPVPVQRADAPTRVLYPIGHGLTYGP
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgccctccagacgtaccctcctcgccgccacggcgggcgtcaccacggccctgaccctc
ggcaccgacgcccaggccgtcagcggccccgacgacaagcggctgcgccgtctcatctcg
cgcatgacgctggaggagaaggtcggccagctgttcgtgatgcgggtctacgggcactcg
gcgaccgcccccgaccaggccgacatcgacgccaacctccaggagctgggcgtccggacg
gcagccgaactgctggcgaagtaccgggtcggcgggatcatctacttctcgtgggcgcac
aacacccgcgacccccaccagatcgccgccctgggcaacggcatccagcgcgcctccctc
gccctcccccgcggcctgcccgtcctggtctccaccgaccaggagcacggcgccgtggcc
cgggtcggcaggcccgccaccctgctgccgggcgcgatggccctcggcgcgggcggctcc
ggcaccgacgcccgcgaggccggccgcatcagcggcgccgaactgcgcgccctcggtgtc
cggcaggactacgcgccggtcgccgacgtgaacgtcaacccggccaacccggtcatcggc
gtccgctccttcggcgccgacccgaaggccgtctcgaagctggtcgccgcccaggtgaag
gggtatcaggaggccggggtggcggccaccgccaagcacttcccggggcacggggacacg
gccgtcgacagccactacggcttcccggtcatcgagcacacccggaagcagtggacggcc
ctcgacgccccgcccttcaaggccgcgatccgcgccgggatcgactcgatcatgaccgcg
cacatcatggtccccgccctggacccctccggcgacccggccaccctctcccgcccgatc
atcaccggcatcctgcgcggcgaactgggctacgacggggtcgtggtcaccgactcgctc
ggcatgcagggcgtccgggagaagtacggcgacgaccgggtgccggtgctggccctgaag
gccggtgtcgaccagctgctcaacccgccctcgatcgacgtggcgtggaacgcggtcctc
gacgccgtgcacgccggcgagctgaccgaggcccgcctcgacaggtcgctcctgcgcatc
ctgcggctcaaggcgaagctgggactgttcgagcggccgtacgtgagtgacgccggggtc
gaccgggtggtggggatcgcgcggcacctcgacgccgccgaccggatcgccgagcggacc
acgaccctcctggtcaacaagggcgggctgctgccgctgaaccgcaccgggcagcgcaag
gtgctggtggtcggcgccgacccggcgtccccgacgggcaccacgggcccgccgacggcc
gtcctcgccgccgaactcacctccctcggcttcacgacgacccggctgccgaccggtacg
gcccccacccaggcggccatcgaccaggcggtcgcggcagcggccggccaggacgtcgtg
gtcgtggcgacgtacaacgtgacggcgaccggtacgcagaagaccctcgtcgcacggctg
atcgccaccggtgtccccgtggtggcggtcgcggtccgcaacccgtacgacgtggcccac
cttcccggggtgaagggctgcgtggccgcgtactcctggacggacgtggaggtgcgggcg
gcggcacgggtgctggccgggcgggtggcgccgcgcggaaagctgccggtcccggtgcag
cgggccgacgccccgacgcgggtgctctatccgatcgggcacggtctgacctacggcccc
tga

DBGET integrated database retrieval system