KEGG   Streptomyces scabiei: SCAB_68491Help
Entry
SCAB_68491        CDS       T01187                                 

Gene name
trpC1
Definition
(GenBank) indoleglycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
scb  Streptomyces scabiei
Pathway
scb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01130  Biosynthesis of antibiotics
scb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCAB_68491 (trpC1)
Enzymes [BR:scb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SCAB_68491 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBG73845
UniProt: C9YVH4
Position
7580053..7580862
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIIDGVRADLAERQARVSLDELKERAAKAPAAKDGAAALRGDGVKVICEVKRSSP
SKGALAAIADPAGLAADYEAGGAAIISVLTEQRRFGGSLADLEAVRARVDIPVLRKDFIV
TSYQLWEARAYGADVVLLIVAALDQPALESLIERAESIGLTPLVEVHDEDEVERAVDAGA
RVIGVNARNLKTLEVDRSTFERVAPEIPDSIVKIAESGVRGPHDLIAYANAGADAVLVGE
SLVTGKDPRTAVADLVAAGEHPALRHGRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgctcgacgagatcatcgacggagtccgtgccgacctcgcggaacggcaggcg
cgcgtcagcctcgacgagctcaaggagcgcgcggcgaaggctccggcggccaaggacggc
gcggccgcgctccgcggcgacggcgtcaaggtgatctgcgaggtcaagcggtccagcccc
tccaagggcgcgctcgccgcgatcgccgacccggccggtctcgccgccgactacgaggcg
ggcggcgcggcgatcatctccgtcctcaccgaacagcgccgcttcggcggctcgctggcc
gacctggaggccgtccgggcgcgcgtggacatccccgtcctgcgcaaggacttcatcgtc
acctcgtaccagctgtgggaggcacgggcctacggcgccgacgtcgtcctgctcatcgtc
gccgcgctcgaccagccggcgctggaatcgctcatcgagcgcgcggagtccatcgggctc
accccgctcgtcgaggtccacgacgaggacgaggtcgagcgcgcggtcgacgccggagcg
cgggtgatcggcgtcaacgcccgcaacctcaagaccctggaggtcgaccgctccacgttc
gagcgggtcgcccccgagatcccggactccatcgtcaagatcgccgagtccggcgtccgg
ggcccgcacgacctcatcgcctacgccaacgccggcgccgacgccgtcctcgtgggcgag
tccctcgtcaccggcaaggaccccaggaccgccgtcgccgacctcgtcgccgcgggcgag
caccccgcgctgcggcacgggcggggctga

DBGET integrated database retrieval system