KEGG   Streptomyces scabiei: SCAB_77231Help
Entry
SCAB_77231        CDS       T01187                                 

Definition
(GenBank) putative beta-xylosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
scb  Streptomyces scabiei
Pathway
scb00460  Cyanoamino acid metabolism
scb00500  Starch and sucrose metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCAB_77231
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SCAB_77231
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SCAB_77231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like GD_AH_C DUF11
Motif
Other DBs
NCBI-ProteinID: CBG74692
UniProt: C9ZB01
Position
complement(8530642..8533092)
Genome map
AA seq 816 aa AA seqDB search
MEPALAQKDHVMTDARSRAIELLGRMTLHEKVAQLTSLIPTMLFDAKGIRPDVAAAKLAN
GIGYIEPHMGGFPANAAELARLNNAVQRHLVENTRLGIPAIMHIEALNGVNAPTFTSFPT
AIALAATWDTTGVGEMAALTRRQMRSVGLHHALSPLLDIARDARWGRVHETYGEDPYLVS
ALGVSFVRNLQGESLLDGVIATGKHFLGYAMSEAGLNMATVPMGARELREVYARPFAAAI
QLAGLGSIMNSLADWDGVPAAADPRVFRKMLRDQLGFNGTVVSDWLSIENLVTHHRAARD
AREAGVLGMRAGIDVEMPEPFGYGDNLVEAVRDGEIPETTVDESVLRVLTHKFQLGLFEN
PYVETDPVEIMSVAQEGRDLSLRLARESVTLLKNDDGVLPLSGAPRIAVVGPHAEAVGTA
FAPYTFPSFIELTRALLNGKTSSMVGVENLDSFGPDDAYVHEEIGDLLAMSEDEFARSRY
EAVSLADALQAALPDSEILVATGCGVTDGAEGIGAAVDVARDADVVVLALGGVARWFFGE
RTEGEGADTADVTLPDVQRRLVHEIAALGKTTVGVIFSGRPLALGDVEPELDAILLGYYG
SQFGTPAVAEILSGTAEPQGRLPYTIPRSSGQVPLHAGQRFGSGYRRREGDPHGGYVDES
AAPLYPFGHGLTYTEFVYSDLQLSSTSIAPDRTVEVTATVTNTGDRPGVELMQLYVEDDA
PGVSRPALQLAGFHRLELQPGDQATVRFALELPLLAYLSLDDRWVVDPGPMWISVGSSSS
DLRLRGRLDVVGDTVDVTRRRVYLTHSARTAPTTGT
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
gtggaacccgcactcgcacagaaggatcacgtcatgaccgacgcacgttcccgcgccatc
gagttgctcggtcgcatgaccctgcacgaaaaggtcgcgcagctgacgtcgctgatcccg
acaatgctcttcgacgccaaaggcatccgcccggacgtcgccgcggccaagctggcgaat
ggcatcggctacatcgaaccgcacatggggggctttccggcgaacgcggccgaactcgcc
cggctcaacaacgcggtacagcgccacctggtcgagaacacccgcctgggcattcccgcg
atcatgcacatcgaggcgctgaacggtgtgaacgcccccaccttcacatccttccccacc
gcgatcgccctcgcggccacctgggacaccaccggggtgggcgagatggccgcactgacc
cgtcggcagatgcgatccgtgggcctgcaccacgccctgtcgccgctgctcgacatcgcc
cgcgacgcgcgatggggccgagttcacgagacgtacggcgaggatccatacctggtcagc
gcgctgggagtgtccttcgtacgcaatcttcaaggcgagtcgctgctggacggggtcatc
gccaccggcaagcacttcctcggctacgcaatgagtgaggccggtctcaacatggcgacc
gtgccgatgggagcgcgcgagctgcgggaggtgtacgcgcgccccttcgccgccgccatc
cagctcgcgggactgggctcgatcatgaactcgctcgccgactgggacggagtgcccgct
gccgccgaccctcgggtgttccgcaagatgttgcgcgaccaactcgggttcaacggcacc
gtcgtgtcggactggctgtcgatcgagaacctcgtgacccatcatcgcgccgcgcgcgat
gcacgcgaagcgggcgtgctcggcatgcgggccggcatcgacgtggaaatgcccgagccg
ttcggctacggcgacaacctcgtcgaggccgtccgcgacggcgagattcccgaaacgacc
gtcgacgagtcggtcctccgcgtactgacgcacaagttccaactgggcctgttcgagaac
ccctacgtggaaaccgacccggtggagatcatgtccgtggcgcaggagggccgcgacctc
tccctgcgtcttgcgcgcgagtccgtcacgctcctcaagaacgacgacggggtgctccca
ctcagcggcgccccgcgcatcgcggtcgtcggacctcatgccgaggctgtgggcacggcc
ttcgccccgtacaccttcccctccttcatcgagctgacccgagcactgctgaacggcaag
acgagttccatggtcggtgtcgaaaacctcgactccttcggccccgacgacgcctacgtg
cacgaggagatcggcgacctgctcgccatgagcgaggacgagttcgcgaggtcgcgctac
gaagcggtctccctggcggacgccctccaagccgcgctacccgactccgaaatcctcgtc
gcaactggatgcggagtcaccgacggggccgaggggatcggcgcggcagtcgacgtcgcg
cgtgatgcggatgtcgtggtcctggcactgggcggcgtggcgcgatggttcttcggtgaa
cggacggagggtgagggtgcggacaccgccgatgtgacgctgccggatgtacagcgtcgg
ctcgtgcacgagatcgccgcgctcggcaagacgaccgtcggcgtgatcttctcgggccgc
cctctcgcccttggtgacgtcgagcccgagctcgacgccatcctgctcgggtactacggc
tcgcagttcggcacacctgccgtcgcggagatcctcagcggcacggccgagccgcagggc
cgcctgccgtacacgatcccccgctccagcggtcaggtccccctccatgcgggccagcgg
ttcggcagcggataccgccgtcgggaaggcgatccgcacggcggatacgtggacgagtcc
gcggcaccgctctacccgttcgggcacggcctgacgtataccgaattcgtctactccgac
ctccagctgagcagcacgtcgatcgcacccgaccgcaccgtcgaggtcaccgcgaccgtc
acgaacacgggcgaccgcccaggcgtagaactcatgcagctctacgtcgaggacgatgcg
cccggcgtgtcgaggccggcgctccagctcgcggggttccatcgcctcgaactgcagcca
ggggatcaggcgacggtgagattcgctctggaactcccgctgctggcctacctgtccctg
gacgacagatgggtcgtggatccgggcccgatgtggatctcggtcggctcgtcgtcgagt
gaccttcgcctgcgcggtcgcctggacgtcgtcggtgacaccgtggacgtcacgcgacgg
agggtgtacctgacccactctgcacggaccgctcctacgacgggaacgtga

DBGET integrated database retrieval system