KEGG   Streptomyces scabiei: SCAB_83081Help
Entry
SCAB_83081        CDS       T01187                                 

Definition
(GenBank) putative glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
scb  Streptomyces scabiei
Pathway
scb00471  D-Glutamine and D-glutamate metabolism
scb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SCAB_83081
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:scb01011]
    SCAB_83081
Enzymes [BR:scb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SCAB_83081
Peptidoglycan biosynthesis and degradation proteins [BR:scb01011]
 Precursor biosynthesis
  Racemase
   SCAB_83081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF498
Motif
Other DBs
NCBI-ProteinID: CBG75261
UniProt: C9YX06
Position
9211965..9212771
Genome map
AA seq 268 aa AA seqDB search
MKIALMDSGIGLLPAAAAVRRLRPDADLVISSDPDGMPWGPRTPQDLTERALAVATAAAA
HAPDALIVGCNTASVHALPALRALLEPGLPVIGTVPAIKPAASGGGPFTIWATPATTGSP
YQRGLIEEFAGGVAVTEVPCWGLAEAVEHADDAAIDAAIAAAAALTPADVTTVVLGCTHY
ELVAERIRAAVQQPGRLPLVLHGSAGAVAAQALRRIGELPKPEADWTGATLTVILSGREG
PLPAPALAYAEGALLRTTAPVPAAHPEQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcgcgctcatggattccggtatcggtctgctccccgccgccgccgcggtacgg
cggctgcggcccgacgcggatctggtgatctcctccgaccccgacggcatgccctgggga
ccgcgcacgccgcaggacctcaccgagcgcgccctcgccgtcgcgacggcggcggccgcc
catgcgccggacgccctgatcgtcggctgcaacaccgcgtccgtgcacgccctgcccgcc
ctgcgcgccctcctcgaacccggtctgccggtcatcggcaccgtcccggcgatcaagccc
gccgcgtccggcggcggccccttcaccatctgggccacgcccgccaccaccggcagcccc
taccagcgcggcctgatcgaggagttcgccggcggcgtcgcggtcaccgaagtgccctgc
tggggtctggccgaagcggtggagcacgcggacgacgcggcgatcgacgccgcgatcgcc
gcggccgccgccctcactcccgcggacgtgacgaccgtcgtcctcggctgcacccactac
gaactggtcgccgagcgcatccgggcggctgtccagcagcccggccgcctgccgctcgtg
ctgcacggttccgccggcgccgtggccgcccaggcgctgcgccgcatcggggaactgccc
aagcccgaggccgactggaccggggcgacgctgaccgtcatcctcagcggccgcgagggc
ccgctgcccgccccggcgctggcctacgcggagggcgccctgctccggacgaccgcgccc
gtaccggccgcccacccggagcagtga

DBGET integrated database retrieval system