KEGG   Sphaerochaeta coccoides: Spico_0030Help
Entry
Spico_0030        CDS       T01469                                 

Definition
(GenBank) hypothetical protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEC01272
UniProt: F4GIB3
Position
32249..33667
Genome map
AA seq 472 aa AA seqDB search
MMKNMVRIHWPWSKKKSPDSSFRKEKTATQDSLPRVAALAAAALRRTREIIGLTGSRLAG
SQAARDAAKLLHDDLAKVCDSTASQTFLMNVGSYAGWIRWVPLLYIIALAFAWASLPMVS
FILFLICAFYAINQFIFFRPVGEITHPKDEGINVHGVIEPSGQARRTIVFSGHHDSARLD
TFSTGSKKEYMSTVFLPFACCMFLFAVVAVLTVGSLFGHSVVPWRSVPVLALLVIATVLW
KMVLPLRTFFSEEASPGAGDNLVSSCIVIELARYFRARTRRGNPLVGTRLVFASFDGEEV
GVRGSRAWFSRNKEQLIPPGTLGYHFNIDCPYRLQDVSFLSTDAHGTVHLSQQFATQCAD
VAQSIGYNVHSQKMPLLAGATDATEGARAGLSATTLMGVSWEDGRKSAPYHTPEDTPDAV
EPEALEAVLAIAIKLVGTLDGLDGEDAMEASEDVTESSDEDAPLKFKRLTKR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaacatggtacggatacattggccgtggagcaagaaaaaatcaccagattca
tccttccgaaaagaaaaaacggcaactcaagacagtcttccacgggtagcggcacttgcc
gccgcagcgttgcgccgtacacgggaaatcatcggattgaccggctcccggcttgccggt
tcacaggccgcgcgggatgcagcgaagctgttgcatgacgacttggcaaaagtctgtgat
tccaccgcaagccagacatttctcatgaatgtcggctcatatgccggatggatacgctgg
gttccactgctctatatcattgcccttgcctttgcctgggcatccctgccgatggtttcg
ttcattttgttcctcatatgcgctttctatgccatcaatcagttcattttcttccgacct
gtcggggaaataacccatcccaaggatgaaggaatcaatgttcacggggtgatagaaccg
tcgggacaagcgcggagaaccattgtattcagcggacaccatgacagtgcccggttggac
acattcagtaccggaagcaagaaggagtatatgtccacggttttcctgcctttcgcctgc
tgcatgtttctctttgccgtggtcgcagtactgactgtcggttccctgttcgggcattct
gtcgttccgtggcgttcggttcccgtacttgccctccttgtcatcgcaactgtcttatgg
aagatggtgcttccgctcaggacattcttttctgaagaagcatcgcccggagccggagat
aacctggtttcctcctgtattgtcattgagctggccagatatttccgcgcccgtacccgc
agagggaaccccttggtcggaacccgattggtttttgccagcttcgacggtgaggaagtc
ggagtacgaggctctcgtgcatggttctcccggaacaaggaacagctcatccctccgggg
acgctggggtatcatttcaacatcgactgtccctaccgactacaggatgtgagcttcctg
tccactgacgcacatggtaccgtacacctgtctcagcaattcgccacccaatgcgctgac
gtggcgcagagcataggatataatgtccattcccagaaaatgccgctgctcgccggagct
accgatgccacggagggagcacgtgccgggctgtcggctactaccctgatgggagtgtca
tgggaggatggcaggaaatccgcgccatatcatacgccggaggatacgccggatgctgtc
gaaccggaagcgctggaagcagtcttggccattgccatcaagctggtcgggactttggac
ggtttggacggcgaagacgcaatggaagccagtgaagatgtgacggaaagctcggatgag
gacgctcccttgaagttcaagcgtctgacaaagaggtaa

DBGET integrated database retrieval system