KEGG   Sphaerochaeta coccoides: Spico_0032Help
Entry
Spico_0032        CDS       T01469                                 

Definition
(GenBank) NUDIX hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
scc  Sphaerochaeta coccoides
Brite
KEGG Orthology (KO) [BR:scc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:scc03400]
    Spico_0032
Enzymes [BR:scc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     Spico_0032
DNA repair and recombination proteins [BR:scc03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Spico_0032
 Prokaryotic Type
    Spico_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX TssN DsbD_2 ZZ
Motif
Other DBs
NCBI-ProteinID: AEC01274
UniProt: F4GIB5
Position
complement(34272..35276)
Genome map
AA seq 334 aa AA seqDB search
MIVRFLAENYLWIIIAILAVNMTQRKYPGTDKKRRATVYIALGALLLNISAVFVLQNEMT
HWLVAVAAIILLVAGFFLRKWVWPFRLHCAGCGKRMDYAHVVGHDDNLCTSCHLEKHPEE
KEKAEAAAQEAERKKQDRVQPARIDYSAARTVEDVDWDVWEPTETCVLTYLLRTSDDGKR
QILLIDKKRGLGDGLVNVPGGHIEVAETATEAAIREFKEETDMDIIDPEYRGVLDFQFTD
GLAMRGHVFTATSWTGTPRETDEARPFWCDEQDLPYEKMWSDDELWLPDMLAGKNVKGVF
IFDDRVMLSHKVELLNRPETLAEDTTEDVAENVK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatagtacgattccttgcagaaaattatctttggatcatcattgcgatccttgcggtc
aacatgacacagcgcaagtaccccggtacagacaagaaacgacgagcgacggtctacatt
gccctgggagcattgctcctcaacatcagtgcagtgtttgtcttacagaacgagatgacc
cactggctggtcgctgtcgcggcaatcattctcctggtcgcaggcttctttctgcgcaaa
tgggtctggcctttccgccttcactgcgccggatgcgggaaacgcatggactacgcccac
gtagtcggacatgacgacaacctttgtacgtcctgtcacctggaaaagcacccggaggaa
aaggaaaaagcggaagctgccgcacaggaagcggaacgcaagaagcaggacagagtccaa
cctgcccgcattgactacagcgccgcccgaaccgtcgaggacgttgactgggatgtctgg
gaaccgaccgaaacctgtgtgctgacatatctgctgcgcacatctgatgacgggaaacgc
cagatactcttgattgacaagaaacgcggccttggggacggtttggtgaacgtacccggc
gggcatatagaagtagctgaaaccgcgacggaagccgccatcagggagttcaaggaagaa
acggacatggatatcatcgaccctgaataccgaggcgtgttggatttccagttcaccgac
ggtcttgctatgcgcgggcatgtcttcaccgcgacatcatggaccgggacgcccagggaa
acagatgaagcccgtccgttctggtgtgatgaacaggatctcccctatgagaagatgtgg
tctgatgacgagctttggcttcccgacatgcttgcggggaaaaacgtgaaaggcgtattc
atctttgatgaccgcgtcatgctcagccacaaggtggagttgctcaatcgtcctgaaact
ttagcggaagacacaacggaagacgtggcggaaaacgtgaagtaa

DBGET integrated database retrieval system