KEGG   Sphaerochaeta coccoides: Spico_0033Help
Entry
Spico_0033        CDS       T01469                                 

Definition
(GenBank) hypothetical protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEC01275
UniProt: F4GIB6
Position
35488..36480
Genome map
AA seq 330 aa AA seqDB search
MAWLKPDVKKLEQRRNVKGLIKAMKYAKDDGTTSMLALMALKDMKAKEAIPAIEKFLMYA
SRQHSDFYTKDTVRRCCDCLRAMDYEPTNQEIGAFYWGNTSQYDKLATCDPALAIPQFFA
FFARGGYCEKWLNAYLALDAVTGFMSLLAFTGQIFEQYKSFTKSTPSINYSLDSDKRKAA
YMEHLVTLLQNAVDVVCAYKHNAAFSYLIQLYNQVNEEIYSDPEGGFPDMFRAVKIRSHI
VVRVGQFPFENFGEQICAFLSNVLNYDRADLVKHEAMMGAEKLPPHLKQYQPLQSGLRTF
YDSLTAQKSSLSMGKSYWLKPLEKLIGLES
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggctgaaaccagatgtaaagaaactagagcaaagaagaaatgtcaaaggtctc
atcaaggcgatgaaatacgcaaaggatgatggaaccacgtccatgcttgcactgatggcg
ctgaaagatatgaaggcaaaggaagcgattcccgcaattgagaagtttctgatgtacgca
tccaggcaacacagtgatttttacaccaaggataccgtgcgacgatgttgtgactgtctg
agagctatggattatgaaccgacgaatcaggaaatcggcgcgttttattgggggaatacg
tcccaatatgataagcttgcaacctgtgaccccgcgttggcgattcctcagttttttgca
ttttttgccagaggtggttattgcgagaagtggcttaatgcgtatcttgccttggatgcc
gtcaccggctttatgtctctgcttgccttcacggggcagatatttgaacaatacaagagc
tttaccaaaagcacgccgtccatcaactacagtctggattccgataagcgaaaagccgcg
tatatggaacatctggttacccttttgcaaaatgctgtagacgttgtatgtgcatataag
cacaatgcggcgttcagctatctgatacagctatacaatcaggttaatgaggaaatttac
tctgatccggagggagggttcccggatatgttccgcgccgttaaaatccgttcccacatt
gtagtgagagtcggccaatttccctttgaaaattttggagagcagatatgcgcgttcctc
tccaacgtgttgaactatgacagagccgatttggtgaagcatgaggcgatgatgggggct
gaaaaattgcccccgcatctaaagcaatatcagcctctgcaatcagggcttcgcacattc
tatgattccttgacggctcaaaagtcatctctatcaatggggaaatcctattggttgaag
ccgctcgaaaaattaataggtctggagagttaa

DBGET integrated database retrieval system