KEGG   Sphaerochaeta coccoides: Spico_0039Help
Entry
Spico_0039        CDS       T01469                                 

Definition
(GenBank) Polygalacturonase
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3 Beta_helix
Motif
Other DBs
NCBI-ProteinID: AEC01281
UniProt: F4GIY6
Position
40581..41960
Genome map
AA seq 459 aa AA seqDB search
MKIFDIREFGAVEGAGHDAGSAIAAAVAEASRHGGEVLIPSGTWHTGPVTLASGITFRLA
EGSRLVFIPDEDLYVPVYSRWEGVSCWCMHPCLFISESHDVTVTGTGVIDGSGKSWWESA
RRKRALHMKPETPMEKKLAALNPGYADQPGGGGGRQCQFLRPPLLQILDSTRVTVEGVTL
TGSPFWTLHPVFSSGLTFRDVKIINPADAPNTDGIDIDSCQDVMVTGCLVDVGDDGIALK
SGSGPDGIAAGRPTRNVRVSGCTVRSAHGGIVIGSETAAGISGLVAEDCLFDGTDRGIRI
KTRRGRGGAISDLRFERLTMRNNLCPLAINMYYRCGTTEGSLFSLSPEPIDDTTPSIGNI
LVRDCVATGSQASAGFIVGLPERPITELVVEDSSFGVMPESNVSTDESDMFLGLPHVDGR
GIRLRNVQGDFRSVKVEGTVPIFVREEGIDVRFWNRKKT
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttcgacatacgggaatttggagctgtcgaaggagccggacatgatgccgga
tctgccattgccgccgcggtcgcggaggcttcccgtcatgggggagaagtactcatccct
tccgggacatggcataccggcccggtgacgctggcttccggcatcacgtttcgccttgcg
gagggctctcgtctggttttcatccccgatgaagatttgtatgtccctgtatattcgcgc
tgggagggtgtctcctgttggtgcatgcatccctgcctgttcatttcagaatctcatgat
gtgactgttaccggaacaggtgtcattgatggcagcgggaagtcatggtgggagagcgca
cggcgtaagcgtgcccttcatatgaagccggaaactcccatggagaagaaacttgctgct
ctcaaccctggatatgccgaccagccagggggagggggaggccgtcagtgccagttcctc
aggccgcctttgctccagattcttgacagtaccagggtcacggtggaaggcgttacattg
acaggcagtccgttctggacgctgcatccggtattcagttccggtttgacattccgtgat
gtgaagattatcaatcctgccgatgcaccgaacaccgatggcatcgacattgattcttgc
caggatgtcatggtcactggatgtctggttgatgtcggggatgatggcattgcactgaaa
agcggcagcggccctgatggcattgcggcaggacggcctacccggaatgtcagggtttcc
ggctgtacggtcaggagtgcccatggcggcattgtcattggcagcgaaactgctgccggt
atcagcggactggtcgcggaagattgtctttttgatggtacggacaggggcatccgcatc
aagaccaggcgtggtcggggcggggctatctccgacctgcggttcgagcggctgacaatg
agaaataatctttgtcccctggccatcaacatgtattaccgttgcggcacgacagaaggg
tctcttttttccctttctcccgaacctattgacgatactacaccttccattggaaacatt
ctggtaagggattgcgtggctacaggcagccaagcgtccgctgggttcattgtggggttg
cctgaacgtcctataacggaattggtggtggaagacagttccttcggtgtgatgccggaa
agcaatgtctctacggatgaatcggacatgttcctggggcttccccatgtggatggacgg
gggattcgtttgcgcaatgtgcagggggatttcaggagcgtgaaggtcgagggaaccgtt
cctattttcgttcgggaagaaggtatcgatgtgaggttctggaacagaaaaaaaacatga

DBGET integrated database retrieval system