KEGG   Sphaerochaeta coccoides: Spico_0051Help
Entry
Spico_0051        CDS       T01469                                 

Definition
(GenBank) regulator of chromosome condensation RCC1
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RCC1 RCC1_2 Mfa_like_1
Motif
Other DBs
NCBI-ProteinID: AEC01293
UniProt: F4GIZ8
Position
complement(53462..55645)
Genome map
AA seq 727 aa AA seqDB search
MVFLTILMLLITFISCDNKLNISNTNAVRFSTEIGRKATANSEWQADDDVGIYMLEHGTG
TAATTAPERANKLYTADTAFQTSGFTPATAGDTLKWDDISNPTITHFDFIAYYPYDENIS
DPTTVAIDINRSSSEQMTGTADFLWGRTDNVQNNTSTVHLKLDHMLSRLIVNIAPSTTVD
AVAINDATGGFTATVKGLNTQTTINLNDGTLDAASVIESIVMKDISDTLTQSERNEGKRR
FEAVLIPEAHSSWLLSVLELEFTLTGGTGAGTYTWIADSVATSDQGKIHFDAGKQHVYNM
TLNTSDEEVAVAAIEIEIQDWDTGDGINAPAVKVGVKSVSAGGYLTMILKTDGTLWATGL
NSYGQLGVGETLLPETKTSTPVPVTSMNADPNNPVVATSGGVLSYNGTGFVSHTMILKKN
GSLWATGHNAYGQLGIGGTTDISTPEQVKGFGGVGVMTDVKEVSAGLYHTMILQKDGTLW
ATGRNNYGQLGVGAELTYTTSIPVQVMTDVAAVSAGEHHAIILKMDGTLWATGQNPYGQL
GDGTMTNRSTPVQVKASTTPDDFMTDVVAVFAGINHTIILKKDGTLWATGSNGYGQLGDG
TTTNRSTPVQVKASTTPSDFMTDVKEVSAGSSYTMILKKDGTLWATGYNEYGQLGLGDIL
PGTNRTTPEQVSSMGSGVAGVSVGNSHTMILKKDGTLWATGRNTDGQLGLGGSIPGSNRT
TPEQVIF
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcctgaccattctgatgctacttatcaccttcatttcatgcgacaacaagctg
aatatttcaaataccaatgcagtgcgtttcagtacggaaatcggacgcaaagccacggca
aattccgaatggcaagccgatgatgacgtcggcatctacatgctggaacatggtactggc
acggcagctactaccgccccagaacgtgcaaacaaactctatacggctgacacagccttc
cagacttccggtttcactcctgctaccgctggtgacaccttgaagtgggatgacatctcc
aaccctaccatcacacacttcgacttcatcgcctattatccctatgatgaaaacatctct
gaccctacgaccgtagccatagacatcaaccggagttcctcggaacagatgaccgggacg
gctgacttcctgtggggacgcaccgacaacgtacagaacaatacctcgacggtgcatctg
aagcttgaccatatgctctcccgcctgattgtcaacatagccccaagcacgactgttgat
gctgtggctatcaatgatgccaccggtggatttactgctacggtcaaaggcttgaacacg
cagaccacaatcaacctgaatgacggaaccttggatgctgccagtgtcattgagtctatt
gtcatgaaggacatttccgacacgcttactcaatctgaaagaaatgagggtaagaggcgg
ttcgaggctgtgctgatacctgaggctcactcgtcgtggttgctgagtgtgctggaactg
gagtttaccctgaccggtggtactggcgctggtacatacacatggatagcggattccgta
gcgacctctgaccaaggcaagattcactttgacgcgggaaagcagcatgtctacaacatg
acgctcaatacctctgatgaagaagtcgccgttgccgctattgagattgagatacaggac
tgggacaccggggacggcataaacgcgcctgctgtcaaggtgggagtcaagtcagtctcc
gccggaggttatctcacgatgatcctgaagactgacggtacgctctgggcgacgggactg
aactcctatggtcaactgggtgtcggcgagactctcctgcctgagacaaaaacaagtact
cccgtgccggtcacgtccatgaatgctgatccgaacaatcctgtcgtggccacctccggc
ggagtcctctcctataacggaaccggcttcgtctcccacacgatgatcctgaagaaaaac
gggtcgctctgggcgactggacacaacgcctatggtcaactggggatcggtggtactacc
gacataagcacgcccgagcaggtcaagggttttggtggggtcggggtcatgactgatgtc
aaggaagtctccgccggactgtatcacacgatgatcttgcagaaggacggcacgctctgg
gcgacggggcggaacaactatggtcaactgggtgtcggcgctgagctaacctatacaaca
agcatccccgtgcaggtcatgactgatgtcgcggctgtctccgctggagaacaccatgcg
ataatcctgaagatggacggcacgctctgggcgactggacagaacccctatggtcaactg
ggtgacggcactatgaccaacagaagcactcccgtgcaggtcaaggccagtaccactccc
gatgacttcatgactgatgtcgtggccgtcttcgccggaataaatcacacgataattttg
aagaaggacggcacgctctgggcgactggatccaacggttatggtcaactgggtgacggc
actacgaccaacagaagcacgcccgtgcaggtcaaggccagtaccactcctagcgacttc
atgactgatgtcaaggaagtctccgccggaagcagttacacgatgatcctgaagaaggac
ggcacgctctgggcgactggatacaacgaatatggtcagctgggcctgggtgacatcctt
cccggaaccaacagaaccacgccagaacaggtttcgtccatgggttctggcgtcgcgggc
gtctccgtcggaaactcccatacgatgattttgaagaaggacggcacgctctgggcgacg
ggacggaacactgatgggcaactgggtctgggtggcagcattcccggatccaacagaacc
acgcccgaacaggtaattttctga

DBGET integrated database retrieval system