KEGG   Sphaerochaeta coccoides: Spico_0053Help
Entry
Spico_0053        CDS       T01469                                 

Definition
(GenBank) hypothetical protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEC01295
UniProt: F4GJ00
Position
58891..59022
Genome map
AA seq 43 aa AA seqDB search
MWPAQRNGLLIVRRVRRYLLMFRSENNLYGRFYVGSRTAVTQT
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgtggccggcacaacggaacggcttgttaatcgttcgacgtgtgcgccggtatctcctc
atgttccggtcagaaaataacctgtacgggcgtttttatgtcggttcccgaactgctgtc
acccagacctag

DBGET integrated database retrieval system