KEGG   Sphaerochaeta coccoides: Spico_0054Help
Entry
Spico_0054        CDS       T01469                                 

Definition
(GenBank) Listeria/Bacterioides repeat-containing protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RCC1_2 RCC1 Mfa_like_1 Flg_new
Motif
Other DBs
NCBI-ProteinID: AEC01296
UniProt: F4GJ01
Position
complement(58960..61344)
Genome map
AA seq 794 aa AA seqDB search
MVILTILVLLVAFVSCVDKPNVSNSNTIRFISEIGRKATADSGWSIGDEVGIYMVEAGED
VATVATTDRDNVQYVADTADITFSGFSPVDASNPLKWDDISTPAITEFDFIAYYPYASSI
ADTTALPIHVYPGSGEQDTGKADFLWGKKAGVQNNTSTVSLTLSHALSRLVVNVGPSTTV
DKDAITGGTLVATVTGINTQATIDLDSGDVAPVVPSDIDVVMKDISGTLTDAERTAGKRR
YEAVLIPTDNTTALSSLGLRFTLGGETYEWAASSVASSDEYRIVLESGKTHVYNMTLNTA
ADEVAVAEILIGIVDWDTGSGVNAAATKAYSLTFDANSATGGSAPGRMYAHEGSQVTLPS
PGTLEKNLHYVYGWNTLPDGNGTQYAASESFTMPAHDVTLYARWVPKVKSVSAGYGHTVI
LAEDGTLWATGWNIYGQLGDGTSGYLNSKSTPVRVKASINPDDFMTNVEAVSAGDYHTMI
LKEDGTLWATGWDQDGQLGINSITTYTGIPTKVTNTNIGEIPIIRSVATGSRHTMLVSTD
DRLWGTGRNNDGQLGLGHLETPVGLPRQVKFTSGPEPFPTVASVATGANHTMIVDTDGKL
WATGNNAMGQLGDGTAGSGANKNLVVPVTTTSTGTLPAIASVIAGAYHTMIVDTNGMLWA
TGDNSSGQLGDTTMDERTIPVPITTTSTGTLPAIASVAAGDTHTMIVDTNGILWATGNNE
YGQLGDGTSGAANNKSTLVQVMTDVAAVYAGCFHTMIVKKDGTLWATGSNFNGQLGLGDS
SSGTDIKTPVQVIF
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggtcattctgaccatcctggttctccttgtcgcttttgtttcatgcgttgacaaaccg
aacgtttcaaactccaacacaatacgcttcatctccgagataggacgcaaagccaccgct
gactccggctggagtatcggggatgaagtcggcatctacatggtggaggccggtgaggac
gtggctactgtcgccacgaccgaccgtgacaatgtgcagtacgtggcagatacggcggac
atcaccttctccggcttctcccctgttgacgcctccaaccccttgaagtgggatgacatc
tccacccctgccatcacagagtttgatttcatcgcctactatccctatgcatcatccatc
gctgataccaccgctctgcccatacatgtctatccgggttccggggaacaggataccgga
aaagctgacttcctgtgggggaagaaggctggtgtccagaacaacacctcgacagtcagc
ctgacgctcagtcatgccctctcccgccttgttgtcaacgttgggccaagtaccaccgtt
gataaggatgccatcacgggcggtacgcttgtcgccactgtcacgggcatcaacacgcag
gcaacaatcgacctggacagcggagatgtggctcctgtcgtccccagcgacattgatgtc
gtcatgaaggacatctccggcacgctcacggatgcggagaggactgcgggcaagcgacgc
tatgaagccgtgttgatacccacggacaacactaccgccctgtcctcccttggtctgcgt
ttcaccttgggtggcgagacatatgaatgggctgcttccagcgtagcgtcctccgatgag
tacaggattgtcttggagagcggcaagactcatgtctacaacatgacactcaatacggcg
gcggatgaagtcgccgtcgcggagattctcatagggatagtggactgggacaccgggagc
ggggtgaacgcggcggcaaccaaggcatacagcctcacctttgatgccaacagtgccacg
ggaggcagtgctccgggacggatgtatgctcatgagggaagccaggtcacactgccgtct
cctggaacgttggaaaagaatctccattacgtctacggatggaatactctgcctgatggc
aacggaacccaatatgccgccagtgagtccttcaccatgcccgcccatgatgtgacgttg
tatgcaaggtgggtgccgaaggtcaagtcagtctccgcgggatacggtcacacagtgatt
ctggcagaggacggcacgctctgggcgactggatggaatatctatggccaactgggtgac
ggcacttcagggtatttgaacagcaaaagtacgcccgtgcgggtcaaggccagtatcaat
cctgacgacttcatgaccaatgtagaggccgtctccgccggagattatcacacgatgatc
ctgaaggaggacggcacgctctgggcgacaggatgggatcaggatggtcaattgggtatc
aacagtattacgacctacacaggcattcccacgaaggtcaccaacacaaacataggagag
atccctattatcaggtctgtcgccactggaagtcgtcatacaatgcttgtaagtacggat
gataggctctgggggactggacgcaacaatgatggtcaactgggtttaggccaccttgaa
acacccgtgggcttgcccaggcaggtcaaattcacctcagggccggaacctttccctact
gttgcctctgtcgccaccggagccaaccatacgatgattgtggatacggacgggaagctc
tgggcgacgggaaacaacgcgatggggcaactgggtgacggcactgcgggctctggagcc
aacaaaaaccttgttgtgccggtcacaaccacatccacgggaactctccccgctatcgca
tctgttatcgctggagcctaccatacgatgattgtggatacgaacgggatgctctgggcg
accggagacaacagttctggtcaactgggcgacactaccatggatgaaagaaccattccc
gtaccgatcacgactacatccacgggaactctccccgctatcgcatctgtcgccgctgga
gacacccacacgatgattgtggatacgaacgggatactctgggcgacgggaaacaacgaa
tatggtcaactgggtgacggtacttcgggtgcagcgaataacaaaagcacgctcgtgcag
gtcatgactgatgtcgcggctgtctacgccggatgcttccatacgatgattgtgaagaag
gacggcacgctctgggcgacaggatccaactttaatggtcaactaggtctgggtgacagc
agttcgggaaccgacataaaaacgcccgtacaggttattttctga

DBGET integrated database retrieval system