KEGG   Sphaerochaeta coccoides: Spico_0068Help
Entry
Spico_0068        CDS       T01469                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00061  Fatty acid biosynthesis
scc00780  Biotin metabolism
scc01100  Metabolic pathways
scc01130  Biosynthesis of antibiotics
scc01212  Fatty acid metabolism
Module
scc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:scc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Spico_0068
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Spico_0068
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Spico_0068
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:scc01004]
    Spico_0068
Enzymes [BR:scc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Spico_0068
Lipid biosynthesis proteins [BR:scc01004]
 Fatty acid synthase
  Component type
   Spico_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AEC01310
UniProt: F4GJ15
Position
82159..82902
Genome map
AA seq 247 aa AA seqDB search
MEMNVHDAVIVVTGGTSTLGEAICRAFLHEGAYVWCGWTSPHGKKRALTLAEEVGSRLLP
LRIDVRDGASVTAARDAVMKEHGYLDVLVNNAGVFTVSSQEDLAEQDWDTVFDTNITGVW
RMVKTFLPVLADGGSIVNISSMNASRPGFGGTAHYDASKGAVSSYTASLAAEVGPRIRVN
AVAPGLIDAPYLHEGDSSLAQSYVRRAALGRLVQASEAADMVLFLASERARAVTGQIFGV
DCGYPLG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaatgtacatgatgccgtcattgtagtgacaggcggaaccagcactttgggg
gaagccatatgccgcgctttccttcatgaaggcgcatacgtatggtgcggctggacttcc
ccacacggaaagaagcgagccttgaccttggcagaggaagtcggctcgcgacttttgccc
ctgcgtattgacgtgcgtgatggtgcctctgtaactgcggcgcgggatgccgtcatgaaa
gaacatggataccttgatgtcctggtcaacaatgccggagtattcacggtatccagtcag
gaagacttggcggagcaggattgggatactgtttttgacaccaacatcacgggtgtgtgg
cgcatggtgaagactttcctgccagtattggctgatggtggttccatagtgaacatctcc
agcatgaacgcatcccgtccgggcttcggcggtaccgcgcattatgatgcctccaaaggt
gccgtgtcttcctatacggccagccttgccgccgaggtggggccgcggatacgggtcaat
gccgtggcgcccggcttgattgatgcgccgtatctgcatgaaggagattcttcccttgcc
caatcctatgtgcggagggcggcactgggtcgccttgtccaggcttcggaggcagcggac
atggtgctgttcctggcttcggaaagggcgcgtgctgtcacaggccagatttttggtgta
gactgcggatatcctttgggatga

DBGET integrated database retrieval system