KEGG   Sphaerochaeta coccoides: Spico_0068Help
Entry
Spico_0068        CDS       T01469                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00061  Fatty acid biosynthesis
scc00780  Biotin metabolism
scc01040  Biosynthesis of unsaturated fatty acids
scc01100  Metabolic pathways
scc01130  Biosynthesis of antibiotics
scc01212  Fatty acid metabolism
Module
scc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:scc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Spico_0068
   01040 Biosynthesis of unsaturated fatty acids
    Spico_0068
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Spico_0068
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Spico_0068
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:scc01004]
    Spico_0068
Enzymes [BR:scc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Spico_0068
Lipid biosynthesis proteins [BR:scc01004]
 Fatty acid synthase
  Component type
   Spico_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AEC01310
UniProt: F4GJ15
Position
82159..82902
Genome map
AA seq 247 aa AA seqDB search
MEMNVHDAVIVVTGGTSTLGEAICRAFLHEGAYVWCGWTSPHGKKRALTLAEEVGSRLLP
LRIDVRDGASVTAARDAVMKEHGYLDVLVNNAGVFTVSSQEDLAEQDWDTVFDTNITGVW
RMVKTFLPVLADGGSIVNISSMNASRPGFGGTAHYDASKGAVSSYTASLAAEVGPRIRVN
AVAPGLIDAPYLHEGDSSLAQSYVRRAALGRLVQASEAADMVLFLASERARAVTGQIFGV
DCGYPLG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaatgtacatgatgccgtcattgtagtgacaggcggaaccagcactttgggg
gaagccatatgccgcgctttccttcatgaaggcgcatacgtatggtgcggctggacttcc
ccacacggaaagaagcgagccttgaccttggcagaggaagtcggctcgcgacttttgccc
ctgcgtattgacgtgcgtgatggtgcctctgtaactgcggcgcgggatgccgtcatgaaa
gaacatggataccttgatgtcctggtcaacaatgccggagtattcacggtatccagtcag
gaagacttggcggagcaggattgggatactgtttttgacaccaacatcacgggtgtgtgg
cgcatggtgaagactttcctgccagtattggctgatggtggttccatagtgaacatctcc
agcatgaacgcatcccgtccgggcttcggcggtaccgcgcattatgatgcctccaaaggt
gccgtgtcttcctatacggccagccttgccgccgaggtggggccgcggatacgggtcaat
gccgtggcgcccggcttgattgatgcgccgtatctgcatgaaggagattcttcccttgcc
caatcctatgtgcggagggcggcactgggtcgccttgtccaggcttcggaggcagcggac
atggtgctgttcctggcttcggaaagggcgcgtgctgtcacaggccagatttttggtgta
gactgcggatatcctttgggatga

DBGET integrated database retrieval system