KEGG   Sphaerochaeta coccoides: Spico_0075Help
Entry
Spico_0075        CDS       T01469                                 

Definition
(GenBank) hypothetical protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEC01317
UniProt: F4GJ22
Position
complement(87066..87803)
Genome map
AA seq 245 aa AA seqDB search
MKDDNFFFFPGERCFRQGSVEQGKAKLFQIQHPHIPTFLRGNSGDGRIIHRFNDYCVLLH
KGKKKITESALRLGKNNRGTSRPWRPCPGIGSQFSQGERADDARLAQRHGDDSLFASIHV
ASYQCFPIVPYQGIPNLRSFFIPGMVRIQGNTHRTMPHRFPSASRKRQEAKKTEDATEQK
SKLTRKKLHDALNAGTRLSVSTVDKALTWGSSPHLYVILRFGWLVRAGGLVCPRLFVAAK
KPLDQ
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgacaattttttcttctttccgggagaaagatgcttccgacaaggttccgtt
gagcagggcaaggccaaacttttccagatccagcatcctcacatccccacatttctccgt
ggcaacagcggcgacggcaggataatccatcgcttcaatgactattgcgtcctgcttcac
aagggaaagaagaaaatcaccgagagcgccctgcgtctgggaaagaacaaccgtggaacc
tcccgaccgtggcgtccatgccccggcatagggagccagttctcccaaggggaacgcgca
gatgacgcacgtcttgcccaacggcacggagatgacagtctctttgccagcattcatgtg
gcgtcgtaccaatgtttccccattgttccatatcagggtataccaaatctccgttccttc
ttcatcccagggatggtgcgcatccaaggaaacacgcacaggacgatgccccacaggttc
ccatccgcatcccgcaagcgccaggaggcaaagaagacagaagatgcgacagagcagaaa
tccaagctgacgagaaaaaagcttcatgatgcattgaatgcgggaacccggctttccgtt
tcaaccgtggacaaggctcttacgtggggaagctcccctcatctgtacgtgatactgcgg
tttggttggcttgtccgagccggtggtcttgtttgtccccggctttttgtggccgcaaaa
aaaccgctggaccagtga

DBGET integrated database retrieval system