KEGG   Sphaerochaeta coccoides: Spico_0078Help
Entry
Spico_0078        CDS       T01469                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
scc  Sphaerochaeta coccoides
Pathway
scc02010  ABC transporters
scc02030  Bacterial chemotaxis
Module
scc_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:scc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spico_0078
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Spico_0078
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scc02000]
    Spico_0078
Transporters [BR:scc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    Spico_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 Hydrolase SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AEC01320
UniProt: F4GJ25
Position
complement(90767..91720)
Genome map
AA seq 317 aa AA seqDB search
MKKIGLLFLIIALLMVPATLFSRGTQESAKDSGKMKIAVVLKTLSSEYWQRVVSGADEAA
AHYGVELIKLGPPTEDAIEQQINMVQDALAQNPAALVFSPSQPPTAVNVMDSAKAKGIPV
VLVDTPMPDGYANYATFIGTENYAAGKLGAEALIKAVGPGAKAIIIEGAPGNPTTTQRAD
GAQAAFQAAGITVLARQPGYSDRERAYTVMQNLLQTHGSVNIVFASNDEMALGALRALQQ
AGVKAAVMGTDGNKEALESILADGLFASVAQKPEAMGYLGVEIAITLANGGTVEKRIDSG
VDVIVKETAQAALDNLK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattggtttattgttcctgatcatcgcgcttctgatggttcccgcaaccctg
ttttcccgtggaacgcaggaatccgccaaggatagcgggaagatgaagattgccgttgtc
ctgaagactctgagcagtgaatactggcaacgtgtcgtttccggcgcggacgaggccgcg
gcacactacggagtggagctcatcaagctcggccctccgacggaagatgccatcgagcag
cagatcaacatggtacaggatgccctggcacagaaccctgccgcattggtcttctcacca
agccagccaccgacagcagtcaatgtcatggattccgcaaaggcgaaaggtattcctgtc
gtccttgttgatacgcccatgcctgatggatatgcgaattatgcgacattcatcggtacg
gagaactatgcagccggaaagctcggtgctgaagctttgataaaagcggtcggtccaggc
gcgaaagccatcatcattgaaggggctcccggaaatccgacgaccacccagagggcagat
ggagcgcaagctgctttccaggccgcgggaatcaccgtccttgcacggcagccaggatat
agtgaccgtgaaagagcatacacggtcatgcagaatctgctacagactcacggaagcgtc
aacatagtattcgcttccaatgatgaaatggcgttgggagccttgcgcgcgctccagcag
gcaggggtgaaagctgctgtcatgggtactgatggaaacaaagaggctttggagtccatt
cttgccgatggccttttcgccagcgtcgcccagaagccggaagccatgggatatcttgga
gttgaaatcgcgattaccctggcgaacggcggtacggttgaaaaacgcattgatagcggt
gtcgatgtcattgtcaaggaaaccgcccaggcagccctggacaacctcaagtag

DBGET integrated database retrieval system