KEGG   Sphaerochaeta coccoides: Spico_0095Help
Entry
Spico_0095        CDS       T01469                                 

Definition
(GenBank) pyruvate formate-lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00620  Pyruvate metabolism
scc00640  Propanoate metabolism
scc00650  Butanoate metabolism
scc01100  Metabolic pathways
scc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spico_0095
   00640 Propanoate metabolism
    Spico_0095
   00650 Butanoate metabolism
    Spico_0095
Enzymes [BR:scc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Spico_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFL-like Gly_radical DUF3029
Motif
Other DBs
NCBI-ProteinID: AEC01337
UniProt: F4GJ42
Position
112270..114663
Genome map
AA seq 797 aa AA seqDB search
MNHFGELHERTAIMRHRLLETQPTVCTERAIATTRAYKEHEMDQVVVKRAHMLDEALRGM
SIYLDEGLLAGNQASADRAAPIFPEYAMDWVVDELDLFDKRDGDRFTISEENKQILRDMH
PYWRGRTLKDKGYAAFPEDARLFYDLGIIKTEGNITSGDAHLAVDYGRVLREGLEGYRGR
VLDAQAHLDLTSFDDLKKSYFYRAVLIVLDAVKAFAGRYADLAEISARTADPVRAGELSE
MARILRKVPMKPADTFHEALQSLWLLHVVLQIESNGHSLSYGRLDQYCLPYYERSRREGM
TEEEGCELLENLWLKTFTVNKIRSWSHTRFSAGSPLYQNVTVGGQTVDGNDAVNELSWLI
LRTVARCHMPQPNLTVRYHRNISHEFMSECIEVIRCGFGMPAFNNDEIIIPSFLEKGVAK
EDAYNYSAIGCVEVAVPGKWGYRCTGMSFLNFPKTLMIALNDGVEINSGRKLYPGNGHFL
QMESFDEVLAAWDVFIREFCRQAVILDSCADMVLEQEVPDILCSALTEDCIGRGKHLKEG
GAVYDFISDLQVGIANLGDSLAAIKKCVYEDRSISRQELWNALLIDFAGEDGERIRQLLL
AVPKYGNDDDYVDSLVVKGYESYIDELSKYKNTRHGRGPIGGCYYAGTSSISANVPQGAG
TCATPDGRHAGEPLAEGCSPTHAVDVKGPTAVFKSVSKLPTHKITGGVLLNQKVSPSMLE
KERDREKLMMLLRTFFNTLHGFHVQYNVVSRTTLLDAQIHPEKHRDLIVRVAGYSAFFNV
LSRQTQDDIIARTEQVL
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttcggggaattgcatgaaagaaccgcaataatgcgtcacaggttgttggaa
acacaacctacagtctgtaccgagcgtgcaatcgctaccacaagggcctataaagaacat
gaaatggatcaagtggtagtgaaacgtgcccatatgttggatgaagcattgaggggcatg
tccatttatttggatgaaggcttgctggcgggaaaccaggcaagcgccgaccgtgcagcc
cccattttcccggaatatgccatggactgggtagtcgatgaactggacttgttcgataag
cgggacggtgatcgattcactatttccgaggaaaacaagcagattctaagagacatgcat
ccctattggagagggcgcaccctcaaggacaagggatacgcggcttttccggaggatgcc
cgattgttctatgaccttggcatcatcaagaccgaagggaacattacttccggtgatgcg
caccttgccgtggattatggacgtgtactccgggaaggcttggaagggtataggggacgg
gttcttgatgctcaagcacatttggatttaacgagtttcgatgatttgaaaaagagctat
ttctaccgtgcggttctgattgtcttggatgcggtcaaagcatttgccggacgttatgcg
gacttggcggaaatttcagccaggaccgcagatcctgtccgggcgggggaattgagtgaa
atggcaaggatcttgagaaaggttcccatgaaacccgcggatactttccatgaagcattg
caaagcctgtggcttttgcatgttgttcttcaaatcgagtccaatggtcattcgctttcc
tatggaagattggatcaatactgtcttccgtattatgaaagaagccggcgagaagggatg
acggaggaagagggatgtgaattgctggaaaatctgtggctcaagacctttacggtcaat
aagattcgtagttggtcgcacactcgtttttctgctggcagcccattgtaccagaatgta
acagtcggcgggcagaccgttgatggaaatgatgccgtcaacgagttgagctggttgatt
ttgaggactgtcgcccgttgtcatatgcctcaaccgaaccttactgtgcgctatcacaga
aatatcagccacgagttcatgtcagaatgcattgaagtcattcgttgcggtttcggcatg
ccagcatttaacaatgatgaaatcatcatcccttcttttttggaaaaaggtgtcgctaaa
gaggatgcatacaactatagtgccataggatgcgttgaagtcgcggttccaggcaagtgg
ggataccggtgtactggcatgagttttctgaatttccccaaaacgctgatgattgctttg
aacgatggagttgaaatcaacagcggtcggaagctgtacccaggaaatggacattttctt
cagatggaatcatttgatgaagtattggcagcctgggatgtctttatccgcgagttctgt
cgtcaggctgtgattctggattcctgcgcggacatggtattggaacaggaggttccggat
atcctttgttctgcattgaccgaggattgcatcggacggggaaagcacttgaaggaaggt
ggagccgtctatgatttcatcagtgaccttcaagtcgggattgctaatttaggagattcc
cttgccgccataaaaaaatgtgtttatgaagaccggagcatttcccgacaggaattgtgg
aatgctctgcttatcgattttgccggagaggacggagaacggatcaggcagcttctgttg
gctgttccgaaatatggcaatgatgatgactatgttgattctcttgtggtcaaaggctat
gaaagctatattgatgaattgtcgaaatacaagaacacccgtcatggccgaggaccgata
ggaggatgctactatgcgggcacctcgtcaatttccgcgaatgtcccccagggcgcgggg
acgtgcgcgactcctgatggccgtcacgccggagagcctctcgcggaaggctgctccccg
actcatgccgtggatgtcaaggggcctaccgcggtatttaaatcggtgtcgaaacttccg
acacataaaattactggcggggtgttgctgaaccagaaagtttccccatccatgttggag
aaggaacgggacagggagaagttgatgatgctgttgcgaactttcttcaatactttgcat
ggcttccatgtgcagtataatgtggtatcgcgcactacgttgctggatgcccagattcat
ccggaaaagcaccgggatctgattgtccgggttgctggttattctgcattcttcaacgtg
ctttcccgacaaacccaggacgatatcattgcccggactgagcaggtgttatga

DBGET integrated database retrieval system