KEGG   Sphaerochaeta coccoides: Spico_0096Help
Entry
Spico_0096        CDS       T01469                                 

Definition
(GenBank) transcriptional regulator, DeoR family
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR HTH_11 MarR HTH_Mga GntR HTH_5 HTH_24 Fe_dep_repress HTH_IclR Put_DNA-bind_N HTH_Crp_2 Rrf2 HTH_AsnC-type HTH_20 MarR_2 FaeA PaaX EAP30 HTH_29 FeoC Syntaxin-6_N HTH_28 RPA_C DUF2250 DUF977 MukB_hinge DDRGK HTH_12 ORC5_C DUF2089 TrmB HTH_23
Motif
Other DBs
NCBI-ProteinID: AEC01338
UniProt: F4GJ43
Position
114663..115406
Genome map
AA seq 247 aa AA seqDB search
MTERKLMIIKLISERGAIEVTELARELGMSAVTIRKDLDQLEQEGLLVRHHGYAVPVSSD
DIRYRMTFNYEVKQKIAKMAAGLVKNGESVMIESGSTCAMLAYELAKSRKDVMIITNSAF
IADFIRRCAAVRITLLGGYYDHDAQVMSGPLTRLCAQQFSVDKFFMGTDGYEVGQGFSNV
DLQRAETVRAMAGSAKHNIIVADSSKFNKRGVVSLMRADEVSYVVTDFVPENCHSDLERN
GVKILLT
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagaaagttaatgatcatcaagttgataagcgaacgtggggcaatagaagtg
acggaactcgctcgtgagcttggaatgtctgccgttactatccgaaaggatttggatcaa
cttgagcaagaaggactactggttcggcaccatggatatgccgtaccggtgtcttccgat
gatatccgttatcgcatgacttttaattatgaagttaaacaaaagattgcgaaaatggcg
gctggtttagtcaagaacggggaatctgtcatgattgaatcaggctctacgtgcgcaatg
ctggcatatgagctggcaaagagccgaaaagatgtgatgatcatcaccaactccgcgttt
attgcggatttcatacgacggtgtgctgccgtccgaatcactctgcttgggggatattat
gatcatgatgcgcaagtaatgtccggtcctttgacccggctttgtgcgcagcagttcagc
gtggataaatttttcatgggtacagatggctatgaagtggggcaagggttttcaaatgtt
gatttgcaacgggctgaaactgtccgcgccatggcgggtagcgccaaacataacataata
gtggcggattcttccaagttcaacaaaaggggcgttgtatcgttgatgcgtgctgacgag
gtttcgtatgtcgtgacggactttgtccctgagaattgtcacagtgatcttgaacgcaat
ggagtaaagatacttcttacgtga

DBGET integrated database retrieval system