KEGG   Sphaerochaeta coccoides: Spico_0101Help
Entry
Spico_0101        CDS       T01469                                 

Definition
(GenBank) transcriptional regulator, LacI family
  KO
K02529  LacI family transcriptional regulator
Organism
scc  Sphaerochaeta coccoides
Brite
Transcription factors [BR:scc03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    Spico_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 TetR_N HTH_31
Motif
Other DBs
NCBI-ProteinID: AEC01343
UniProt: F4GJ48
Position
120632..121639
Genome map
AA seq 335 aa AA seqDB search
MAMTTIKDVARVAKVSTATVSHVFNGTRFVSEKTTERVRRVAQDLGYVSNINAVGLRSNK
TKRIGLLVPAIASFFYVDILDAIEQVLVKNGYQLVIGCSHENLQREKEQVGIFNFQQIDG
MLMFPAPGDHGYLDVMPRKYPIVFIDREAEGCCRDAVIGDNFNSTYEAISCVINEGHQMI
GILSGPEGISALKERVQGYKQALQEHGIVFDPELVVSDVSSSTGGYEATRRLLFHRRPTA
ILSLSPAMAVGCLQYLHEHDIKVPEEIALLSFGDTEWMSVTAPPLTALQHPMFDIGQLAA
KVLLKRLEEEQDSGKPREDFQTYRLPVSMIRRDSF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctatgacgacaattaaagatgtggcgagggttgccaaggtttctacggcaaccgta
tcccatgtattcaatgggactcgttttgtatctgagaaaactacggagagggtacgtagg
gtagcacaggatcttggatacgtatccaatatcaatgccgttggactgcgtagcaacaag
acaaaacggattggactgcttgttccggcaattgcctccttcttttatgtggatatcctt
gatgccatagaacaggtgctggtcaaaaatggatatcaattggttatcggatgttcccat
gaaaacctgcaacgtgaaaaagaacaggtcggtattttcaattttcagcagattgacggt
atgctgatgtttcccgctcccggtgaccatggctatcttgatgtaatgcctcggaaatat
cccattgtgttcattgaccgggaagcggaaggttgttgccgggatgccgtgatcggtgat
aacttcaactccacgtatgaggctatttcctgtgtaatcaatgaaggtcatcagatgata
ggcattctcagtgggcctgaaggcatttcagcattgaaggaacgcgtacaagggtataag
caggccctacaggagcatgggattgtttttgatcctgaactggtggttagcgatgtatca
tccagcacaggcggatatgaagcaacgcgccgcttgcttttccataggagaccgacggct
atcttgtcattgtctcctgccatggctgtcggttgtctacagtatttacatgaacatgat
atcaaggttcctgaagaaatagctctgctttcttttggagataccgaatggatgtctgta
acggctccaccattgacagctttacagcatcccatgtttgacatcgggcagcttgctgcc
aaagtattgctgaaaagacttgaagaagaacaggattctggcaagccgagggaagatttc
cagacataccgtcttcctgtcagcatgattcggcgggactctttttga

DBGET integrated database retrieval system