KEGG   Sphaerochaeta coccoides: Spico_0102Help
Entry
Spico_0102        CDS       T01469                                 

Definition
(GenBank) oxidoreductase domain protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C NAD_binding_3 Shikimate_DH F420_oxidored Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEC01344
UniProt: F4GJ49
Position
121705..122808
Genome map
AA seq 367 aa AA seqDB search
MEKIRIGLIGAGMISQKHLQMYREIPEAQVVAVCSRTRSSAERCAQEWGIENVHTDIQQM
LAQDDIDAVDICLHTILHAPVAIAALNAGKHVYCEKPLAMSYVDGAAMLEAARRNDRTLH
IQLGFLYRPNVRAAKRLVDGGALGDIYHARSMGFRRRNRPYVDGYGSADFVERKYSGGGA
LYDFGVYHISQLLYLMGMPRPLSMSGKLHQAIPMDESRRISGHYDVEELGVGLVRFEKGM
TMDLFESWAVHLDSMDPSILLGSRGGIKLEPFSFHTTFCDLELDCTGDLEKMDFRWKNTL
PYEYAYASSEMHWIAALLQKVPLLPTAELALQTLLIQEGITLSNRLGREVSAEETIESSI
LSDLRLS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaatacgcataggacttattggcgcgggaatgatttctcaaaagcatctacag
atgtaccgggaaattcctgaagcccaggtagtggcagtatgcagtcgcacgcgatcttcc
gctgaacggtgtgcgcaggaatggggcattgaaaacgttcatacggatattcaacagatg
cttgcgcaggatgacatagatgctgtggacatttgcctgcacacgatcctgcatgctccg
gtcgccattgctgcgttgaatgccggcaagcatgtctattgcgagaaaccgctggcaatg
tcttatgtcgatggagcagctatgcttgaagccgcgcgacgcaatgaccgtacactgcat
attcagttgggattcctgtaccgccccaatgtccgggcagcaaaacggctggtagatggc
ggcgccttaggagatatataccatgcgcgttccatgggattcagacgcaggaaccgtcct
tatgtggacggatatggaagtgctgatttcgttgaaaggaaatattccggtggcggtgct
ttatatgatttcggcgtatatcatatttctcagcttctgtatctcatgggaatgccacgc
cccttgagtatgagtgggaaactgcatcaggcaattcctatggatgaatcccgacgtatc
agcggacattatgatgttgaggaactgggggttggactggtacgctttgaaaaaggcatg
accatggacctttttgaatcatgggcggttcatcttgactccatggatcccagcatcctg
ttgggctcccgtgggggaataaagcttgaaccattcagctttcatactactttctgtgat
ttggaactggattgtaccggtgacttggaaaaaatggattttcgttggaagaatacgctt
ccatatgaatatgcctatgcctcgtctgaaatgcactggattgcggctctgcttcagaag
gttcctttgttaccgaccgcagagctggcacttcaaaccttgctgattcaggaaggtatt
acgctgtctaacaggcttgggcgtgaagtaagcgcggaagaaacaattgaaagttcaatc
ctctctgatctcagactttcttga

DBGET integrated database retrieval system