KEGG   Sphaerochaeta coccoides: Spico_0107Help
Entry
Spico_0107        CDS       T01469                                 

Definition
(GenBank) Extracellular ligand-binding receptor
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
scc  Sphaerochaeta coccoides
Pathway
scc02010  ABC transporters
scc02024  Quorum sensing
Module
scc_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:scc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spico_0107
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Spico_0107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scc02000]
    Spico_0107
Transporters [BR:scc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Spico_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5
Motif
Other DBs
NCBI-ProteinID: AEC01349
UniProt: F4GJ54
Position
129123..130334
Genome map
AA seq 403 aa AA seqDB search
MKKTWMLILFFAVFGFAALTAGGQKEPASQGKPEAARTSIATDSSGIRYNGRNKLSMFAP
LTGDNRQYGIKIRDGAELALNQFNAEHGTQFTIEFHDDKGDSNEAINLASKIVSDSTVFA
ALAGYGSSCAMATAPVFDENGMILMGVAASHADLPRMGEYVFPIPMSARLESVNFAQAIK
EYFGVGKIAILYQNTDHGVQQSGLIKKEWEGFGGETVVYESFVPGETKDFSAVLSKIKSK
TPDILFVSAAYNDAAQIFLQANQLDLDVQYVGPGMCLNEEFTRLVGTDIDGAYILSSTPS
FLPSVLESGNIDEITKDFISAYKEAYGETPDGFSAQGYDTVNIVLNSALAAGTTDTDAVA
RQIKAIRSYPGLSGFNMGYNDQKEMNKGIYVFEIQNGTFVRVN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacatggatgttgatcctttttttcgcagtgttcggatttgcggcgttgacg
gcgggagggcagaaggaaccagcttctcagggtaagccggaagcggctcgaacctcgatt
gctacggacagctcaggcatcaggtataatggaagaaacaagctgtccatgtttgcaccc
ctgaccggcgacaaccgtcagtatggcataaaaatcagggatggcgctgaattggctctc
aatcagttcaatgcggagcatggtactcagttcaccattgaattccatgatgacaaaggg
gattcgaatgaagccataaacctggcaagcaagattgtatctgatagcacggtctttgct
gctcttgcgggttatggttcatcctgtgccatggcgacggctcctgtatttgatgagaat
ggtatgattctgatgggcgtggctgcttcacacgctgatttaccgcgcatgggcgaatat
gtatttcccattcccatgagcgcccgtctggagagcgtcaactttgcccaggccatcaag
gaatactttggtgtcggaaaaatagcaatcctgtatcagaacacggatcacggcgtacag
caatctggcctgattaagaaagaatgggaaggattcggtggcgagaccgtcgtatatgaa
agctttgttcccggtgagacaaaagacttttccgctgtgttgtccaagataaaaagcaaa
accccagatatcctgtttgtcagcgccgcatataacgatgccgctcagatttttcttcag
gcaaaccaattggatctggatgtccagtatgtcggacccggcatgtgtttgaatgaagaa
ttcaccagactggtgggtactgacatcgacggtgcgtatattctcagttccactccttct
ttcttgccttcagtcctggaatccggcaatatcgatgagataaccaaggacttcatcagt
gcctacaaagaagcgtatggagagactcctgatggtttctcagcccaaggatatgacacc
gtcaacattgtccttaacagtgccttggcagcaggtacgaccgatactgacgctgtggca
cggcagatcaaagccatccggtcttatccaggactttcaggcttcaacatgggatacaac
gaccagaaggaaatgaacaaaggcatctatgtttttgaaatacagaacggaacctttgta
cgggtgaactga

DBGET integrated database retrieval system