KEGG   Sphaerochaeta coccoides: Spico_0113Help
Entry
Spico_0113        CDS       T01469                                 

Definition
(GenBank) UPF0597 protein yhaM
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: AEC01355
UniProt: F4GJT0
Position
134914..136182
Genome map
AA seq 422 aa AA seqDB search
MKKTEQNYQHYVGILKEELIPAGGCTEPVAIAYVAATARKVLGVMPERMDVFASGNLIKN
AMGVYIPNGGNLRGVGAAAVLGVVGGNADRKLEVLLDMPTGKVIEARKLLEQNFCAVSVL
EHSEALHLIVRVQAGADWVEVELKNAHTHIVRIEKNGAVVFCCDDEEMVRDGLTDHKCLN
IAQIVDFADTCDIGDVEEVLDRQISCNLRIAEEGLKNDWGVNVGKLYYRNGKLLQAYAAS
ASDARMGGCDLPVVIVCGSGNQGATASLPVILYAREKGLSHERLLRALVLSNLIVIHLKR
GIGRLSAYCGVVCAATGSGCALTYLDGGTLHQIEQTITNSLGTASGVICDGAKPSCAAKI
ALCLESAIMAHQLAMEGQAFQSGEGIVMDSVEKTIDAVGCMASKGMYATDCVILNLMTKE
KE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacagaacagaattatcagcactatgtgggcatattaaaggaagaactgatt
cctgccgggggatgtacggaacctgtcgccattgcttatgtggcggcgacagcccgtaag
gtcttgggtgtcatgcctgaacgcatggatgtttttgcgagcggcaatctgattaagaat
gctatgggtgtctacattcccaatggagggaacctgcgtggtgttggcgcggcagcggtt
cttggtgttgtcgggggcaatgctgacagaaagctggaggttctgctggatatgcccacg
ggcaaggtcatcgaggcgcggaagttgttggaacagaatttctgtgcggtcagcgttctg
gaacattcagaggctttgcatctgattgtcagggtacaggcaggagcagactgggttgaa
gtcgaactgaagaatgcccacacgcatatcgttcgcatagaaaaaaacggcgcagtcgtt
ttctgttgtgatgacgaggaaatggtacgtgatggattgactgaccacaagtgcctgaat
atagcacaaatcgtagacttcgcggacacgtgtgacataggggatgtcgaagaagtcctt
gaccggcagatctcctgcaatctgagaatagcggaagaaggattgaagaatgactggggt
gtcaatgtcggcaagctttattacagaaacgggaagcttctccaagcatatgccgcatca
gcgtctgatgcccgcatggggggatgcgacctgccggtcgtgattgtctgcggcagcgga
aaccaaggcgcgacagcttccctgcctgtcatcctctatgcccgtgagaaagggctatcc
catgaacgcctcctgcgggcgttggtactttccaacctgattgtaatccatctgaaaagg
gggattggtcggctttccgcgtattgtggagttgtctgtgccgccacgggtagtggctgt
gcccttacgtatctcgatggagggactctgcatcagattgagcagacaattaccaattcc
ctgggcactgcttcaggtgtgatatgtgatggcgcaaaaccctcatgtgccgcgaagatt
gccctgtgcctggaaagtgcgatcatggctcaccagttggcaatggaagggcaggctttt
cagtcgggagagggcattgtgatggattctgttgagaaaaccatagatgccgtcggatgt
atggcgagcaaaggcatgtatgctacggattgtgtcattctcaatctcatgacaaaggaa
aaggaataa

DBGET integrated database retrieval system