KEGG   Sphaerochaeta coccoides: Spico_0115Help
Entry
Spico_0115        CDS       T01469                                 

Definition
(GenBank) glycyl-radical enzyme activating protein family
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
scc  Sphaerochaeta coccoides
Brite
KEGG Orthology (KO) [BR:scc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Spico_0115
Enzymes [BR:scc01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     Spico_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-ProteinID: AEC01357
UniProt: F4GJT2
Position
137349..138107
Genome map
AA seq 252 aa AA seqDB search
MEAVLLNIQHFCLHDGPGIRSTIFFKGCNLRCHWCANPESISMKVRPELEESLGGRIWKL
EEVLHDVLKDKVFYDESGGGVTLSGGEPLLQADFACALCDALHAHGVAVAIETAACVPEQ
TFMKVFEKLDVAHIDLKHWNDASYRQGTGAGIDLVLSNIRRALAGSIPVFLRIPIIPGFN
DSLEDARQFGNVLADVGANAVQLLPFHQFGEKKYEKLALEYSMNGIAQLHDEDVQDYASV
LKESGLHVQISG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggtattgctcaatattcagcatttttgtctccatgatggaccgggaatccgt
tccaccatttttttcaaaggatgtaatctcagatgccattggtgcgcaaaccctgaatcc
atctccatgaaggtacggcctgaacttgaagaaagtttgggaggaagaatatggaagctg
gaggaagttcttcacgatgtattgaaagacaaagtgttttacgatgaaagcggtggtggt
gtgaccttgtcagggggggagcctttgcttcaggcagatttcgcttgcgccctctgtgac
gctttgcatgcgcacggtgtcgccgttgccattgagactgccgcctgcgtaccagaacag
acattcatgaaagtttttgaaaagttagacgtagcccatatcgatctcaagcattggaac
gatgcatcctatcggcaaggaacaggggcgggaatagatctggttctctcaaacatccgt
agagctctcgcaggatccattcccgtgtttttacgtattcccattattcccggattcaac
gatagcctggaggatgcccgccagtttggaaacgtgctggccgatgtcggtgcgaatgcc
gtgcagttattgcccttccaccaatttggtgaaaaaaaatatgaaaaactggcactggaa
tactctatgaatggcattgcccaactccacgatgaagacgtgcaggactatgcttcagtt
cttaaagaatcggggcttcacgtccaaatcagcggatag

DBGET integrated database retrieval system