KEGG   Sphaerochaeta coccoides: Spico_0116Help
Entry
Spico_0116        CDS       T01469                                 

Definition
(GenBank) Peptidase S54, rhomboid domain protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhomboid DUF1751
Motif
Other DBs
NCBI-ProteinID: AEC01358
UniProt: F4GJT3
Position
138605..139372
Genome map
AA seq 255 aa AA seqDB search
MKKPCRSDTVHSRCAEIAHLTKFFPLATLADMKNSFLNRRLGYSYANYTLRLIIVNILVF
ILTEYIYPSGYVLSGGQLYYTPGVTYYLAMRPALVMKGYVWQFISYMFVHSGVSHILFNM
LGLFIFGSMVERRIGSREFLLFYMLTGIVSGVFSFIAYMAAGTSAVSLVGASGVIYGIML
MFATFFPDARIFVFGIFPVRAPMLVIIYFAIELFSQIRGGGNVAHLTHLAGLGVAYLYSV
LRFRIKPFSVWFGRR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccgtgcagaagcgacacggttcacagcaggtgcgcagaaattgcacatttg
acgaagttctttcctctcgctactttagcggatatgaagaacagttttctaaaccgtcgc
ctggggtattcttatgcgaattacaccctcagactcatcatcgtcaacattttggtcttc
atcctgaccgaatacatctatccttccggctatgtcttgtcaggaggacagctctactac
actccaggagtcacctattaccttgccatgcgaccggccttggtgatgaaaggatacgtc
tggcagtttatcagctatatgttcgttcattccggagtctcccacatccttttcaacatg
cttggactattcatcttcggcagcatggtggaaagacggataggctcccgtgagttcctg
ctgttctacatgcttacgggcatagtgtccggtgtattcagtttcatcgcttacatggca
gcgggaacttcggctgtttccttggtgggtgcatcgggagtgatttatggaatcatgctc
atgttcgcaacattcttcccggatgccaggatattcgtattcggcatatttccggtacgg
gcgccgatgttagtcatcatctactttgccatcgaacttttcagccagataagaggaggc
ggaaatgtcgcccatctcacccatctggcgggactgggagtcgcatacctgtacagtgtg
ttgcgtttccgcatcaaacctttttctgtctggttcggacgacggtaa

DBGET integrated database retrieval system