KEGG   Sphaerochaeta coccoides: Spico_0117Help
Entry
Spico_0117        CDS       T01469                                 

Definition
(GenBank) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00230  Purine metabolism
scc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Spico_0117
Enzymes [BR:scc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     Spico_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-ProteinID: AEC01359
UniProt: F4GJT4
Position
complement(139373..140494)
Genome map
AA seq 373 aa AA seqDB search
MIAPSGLHVYCTDMVTREIIHKAPKVELHDHLDGGLRPATVLELAKEYNVSIPADNADAL
AEWFVLGSKRKSLSLYLETFEVTVSVLQTMEALRRAACEAMEDLAADNVVYAEIRFAPSL
HRRKGLKGEEIVSAVLAGLEDGRRVTGMEYGLIICAMRGQNPALSREAAELAIAFRDRGV
VGFDLAGDEAGNPPRKHLDAFQYIRNQNFNLTIHAGEAFGVESIWQAIQVCGAQRIGHGT
RLVEDMLIHDGRVADMGTLSHFILDRRIPMEVCLTSNVGTGAAKDFASHPFRLFFQNKFR
VFLCTDNRLVSGTTLTDEYAIAAHAYGLSLDDIEKLNINAMKSAFLHHEQKLSLIYKVIK
KGYAELRQGIGTV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgattgccccatcagggctacacgtgtattgtacagatatggtgacaagagaaatcata
cacaaggctccgaaagtggagttgcacgaccatcttgacggagggctccggcccgctaca
gtccttgagctagcaaaggaatacaatgtttcaattccggcggacaatgctgatgctctc
gccgaatggttcgtcctgggcagcaaacgcaaaagcctttcactttatctggaaactttt
gaagtgactgtcagcgtcctgcaaacaatggaagccctccgccgtgccgcatgtgaggcc
atggaggacttggcggcggataatgtggtctatgctgaaatacgttttgccccatccttg
cataggcgaaaagggctgaaaggtgaagaaattgtgtcagcggtcctggccggactggaa
gacggacggcgggtgaccggcatggaatacggcttgataatctgtgccatgcgtggacag
aaccccgccctgtcacgtgaagccgctgaacttgccatagcgttccgggaccggggagtc
gtcggctttgacctggccggtgatgaggcaggcaatcctccccgcaagcatctggatgca
ttccagtacatccgcaaccaaaacttcaacctcaccatccatgccggtgaagctttcggc
gtcgaatcaatctggcaggccatccaagtctgcggcgcccagcgcataggccatggaacc
cggctggtggaggacatgctcatccatgacggcagggtggcggacatgggtacgctttcc
cacttcatcctcgaccgccgcatccccatggaggtatgcctgaccagcaatgtaggcacg
ggagcggccaaggatttcgcgtcgcatcccttccgtcttttttttcagaataagttccgc
gtgttcctctgcacggacaaccgtttggtcagcgggacgacactgaccgacgaatacgcc
atagcagcccacgcatatggattatccttggacgacattgaaaagctgaacatcaatgca
atgaaatctgcgttcctccaccatgagcagaaactcagcctcatctacaaagtgatcaaa
aaaggatatgcggagctccgtcagggcataggcacagtctga

DBGET integrated database retrieval system