KEGG   Sphaerochaeta coccoides: Spico_0121Help
Entry
Spico_0121        CDS       T01469                                 

Definition
(GenBank) transketolase subunit A
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00030  Pentose phosphate pathway
scc01100  Metabolic pathways
scc01110  Biosynthesis of secondary metabolites
scc01120  Microbial metabolism in diverse environments
scc01130  Biosynthesis of antibiotics
scc01200  Carbon metabolism
scc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spico_0121
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Spico_0121
Enzymes [BR:scc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Spico_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh XFP_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEC01363
UniProt: F4GJT8
Position
143877..144734
Genome map
AA seq 285 aa AA seqDB search
MTRLDDAAVKALTDKALELREMTIREIAALGNGHIGGSMSIMELLTYLYYHEMNNLDSKN
PNRWDRDRLVCSKGHAGPAVYAVLASKGYFPVEWLETLNKGGTNLPSHCDMNKTPGIDFT
TGSLGQGASAAVGIALGQKIQQLDGSYTYLIVGDGESQEGQVWEAAETAAQWKLGNLIAF
TDFNRQQLDGYCEDIVSMNNIDTRWLGFNWHVQRINGHDFQQIAQAIAKAKEVTDRPSMI
IMDTIKSQGYAPGVGIQSNHSMTVSKEDAEKAIKLLKAGYKGAQA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggcttgatgatgctgccgtcaaggctttgacggacaaggcccttgagttgcgc
gaaatgactattcgcgagatagcggccttgggcaatggtcatataggcgggagcatgtcc
attatggagctgcttacctacctgtattaccatgagatgaataacctggattcaaagaat
cccaatcgttgggacagggatcgcctggtctgttccaagggtcatgccggtccggcagtg
tatgctgtgctggccagcaagggatatttccccgtggaatggcttgagacgctcaacaaa
ggtggtacgaacctgcccagtcactgtgacatgaacaagactccaggaattgacttcacc
acaggttccctcggacaaggcgccagtgctgcggtcggcatagccttggggcagaagata
cagcagcttgacggttcctacacctatctgattgtcggtgatggcgaaagccaggaaggc
caggtatgggaggccgccgagactgccgcccaatggaagctgggcaatctcattgctttc
actgatttcaaccgccaacagcttgacggctattgcgaggacattgtatcgatgaataac
atcgacacccgctggcttggcttcaattggcatgtgcagaggattaacgggcatgacttc
cagcagattgctcaggccatcgcgaaagcgaaggaagtcaccgaccgtcccagtatgatt
atcatggataccatcaagagtcaggggtatgctcccggcgtgggaatccagagcaaccat
agcatgacggtgagcaaggaagacgctgaaaaagcgataaaactgctgaaagcagggtac
aagggggcacaggcatga

DBGET integrated database retrieval system