KEGG   Sphaerochaeta coccoides: Spico_0130Help
Entry
Spico_0130        CDS       T01469                                 

Definition
(GenBank) hypothetical protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MuF_C
Motif
Other DBs
NCBI-ProteinID: AEC01370
UniProt: F4GJU5
Position
complement(153600..154793)
Genome map
AA seq 397 aa AA seqDB search
MEQKATLIKKRAMDNPRPDKNFSPSEEFCFLPNKYIAKTFEEEADYIDTQYKNGRTAPTV
DGGRPLALGNTPFLLSELGFGYGRIEMLPQVVGKATGQEDRRVTNQHIHHVSLSVLQRLP
YWLWDPVAIIAWTSEKAPLRLMIVSNYLVKNQPVIAILEMEQTSDFGKHCFVTMFEHNMA
IGNNNSIFHKWAQEKKFLYTKKRDWSELSFTSIDGRQGREWYPSTWLLLDVPTRDDLLAR
YESRQERRYFLLGLDLEDPASEEMYDREEIKMLRLGYPVINPIDLRKGEDPGPYTHLGLV
APPGIILTQENINTASQTTGRPAMPTYAILPSLRDLKKERTVIGKDPEQKKENEHPHSLP
PQREKEIPAGGNQEKTKPVDPQKEPPRTLDDDFGLER
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaaggcaacgctgattaaaaaaagagccatggacaacccacgccctgacaag
aatttttccccctctgaagagttttgctttctccctaacaaatacatcgcaaaaacattt
gaagaggaggcggattacattgacacccagtacaagaatggcagaaccgctccgaccgtg
gacggcggccgtcccctggcgctgggaaatacccctttcctgctgagcgaactcggcttc
ggatacggcaggatcgagatgctcccccaggtcgtgggcaaggcgaccggtcaagaggac
cgtcgcgtgacgaaccagcacatacatcatgtgtccctgagtgtcctgcaacgtctcccc
tactggctctgggatccggtggccatcatcgcctggacatcagagaaagcccctttacgc
ctgatgatcgtcagcaactacctggtgaaaaaccaaccggtgatcgccatcctggagatg
gagcaaacaagcgacttcggtaagcactgcttcgtcacgatgttcgaacacaacatggca
attggcaacaacaactctatcttccacaagtgggcgcaggagaaaaaattcctatacacc
aagaaacgggactggagcgagctatccttcacctccatcgacgggagacaggggagagag
tggtatccatcgacgtggctcctgctcgacgttcccacccgagacgaccttctcgcgcga
tatgagagcagacaggagcgccgctacttccttctcggattggacctggaggatcccgcc
tcagaggaaatgtacgacagggaggagataaagatgctccgcctcggctatccggtcata
aaccccattgacctgcgtaagggagaagatccggggccgtatacccatctcggccttgtc
gcccctcccggcatcattctcacacaggagaatatcaacaccgcctcacagactacggga
cgccccgccatgcccacgtatgccatcctcccctctttgcgcgacctcaagaaggaaaga
acggtcataggaaaggatcctgaacagaaaaaagaaaacgagcatccccactctctccct
ccacagagagagaaagagattcctgccggaggaaaccaggagaaaacaaaacccgtcgac
ccgcagaaagaaccccccaggacgctcgatgacgacttcggccttgagcggtga

DBGET integrated database retrieval system