KEGG   Sphaerochaeta coccoides: Spico_0132Help
Entry
Spico_0132        CDS       T01469                                 

Definition
(GenBank) hypothetical protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amido_AtzD_TrzD
Motif
Other DBs
NCBI-ProteinID: AEC01371
UniProt: F4GJU6
Position
155712..156173
Genome map
AA seq 153 aa AA seqDB search
MAKKDEVRIQIRNSTTDFLVFTKENGGDGVDVLVADESVWLIPGGIVSLYDSSKSTISEH
VTNIFARRELDEDSVVRDFRTTAADDTMCSYKDYNHLAFVAEGEYKKYRVIQDRLFQKAG
KPQNRRTSNEPFERTCLSQKGVIIMRKTRRPHP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaagacgaggtcagaatccaaatccgcaacagtaccaccgattttcttgtg
ttcactaaagaaaacggtggcgatggcgtggatgtattggtcgccgacgagagcgtctgg
ctgataccgggaggcatcgtgtcgctttacgactcctcaaaaagcaccatctccgagcat
gtgacgaacatcttcgccagaagagagcttgacgaggattcagttgttcgggatttccga
acaactgctgccgacgacacgatgtgttcttacaaagactacaaccatctggctttcgtc
gccgaaggcgagtacaagaaataccgcgtgatacaagacaggctgtttcagaaggcgggg
aagccgcaaaacaggaggacgagcaatgagccttttgagcggacatgtttatctcagaaa
ggagtcatcataatgaggaaaacaaggaggccccatccatga

DBGET integrated database retrieval system