KEGG   Sphaerochaeta coccoides: Spico_0135Help
Entry
Spico_0135        CDS       T01469                                 

Definition
(GenBank) membrane protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUSC_2 ArAE_1 EI24
Motif
Other DBs
NCBI-ProteinID: AEC01373
UniProt: F4GJU8
Position
158054..158575
Genome map
AA seq 173 aa AA seqDB search
MKAKEYLSRMSRELLDHKFILYMVKCVMGTGICYLFYALWPERHLHWSIISVLLVLAPDR
QDSLTLSVMRMKANIVGGLMGLFVFVVPFPQIIALLSGVFLTILACKLLLAESSTRSAMA
ALIIVSLMEGDAGGWLVALDRMLSVLIGCVVALALTVMFDAVDKKSTTSAKGE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccaaagaatacttgagtcgcatgagtcgggagcttctcgaccataaatttatc
ctttatatggtaaaatgtgtcatgggaacgggtatttgctacctgttctatgccttatgg
ccagaaagacacttacactggtcaatcatttccgttcttcttgtcttggctcccgaccgg
caggattcactgacactctccgtgatgcgcatgaaagcgaacattgtcggcggactgatg
ggacttttcgtgttcgtggttccctttccccagataatcgcattgctttcaggagtcttc
cttactatcttggcgtgcaagttgttgctggcggagagttcgacccgtagcgccatggcc
gcgctaatcatcgtctccttgatggaaggggatgccggaggctggctcgttgccttggac
aggatgctttccgtcctcataggatgcgtagtcgctttagccttgactgtcatgttcgac
gcagtggacaaaaaatccaccacatcggcgaagggggagtaa

DBGET integrated database retrieval system