KEGG   Sphaerochaeta coccoides: Spico_0136Help
Entry
Spico_0136        CDS       T01469                                 

Definition
(GenBank) Appr-1-p processing domain protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Macro SIP
Motif
Other DBs
NCBI-ProteinID: AEC01374
UniProt: F4GJU9
Position
158576..159118
Genome map
AA seq 180 aa AA seqDB search
MGFSIIKGDITHQSVDAIVNAANTRLLGGSGVDGAIHAAAGPQLLEECRTLGGCETGKAK
ITDGYLLPARHVIHTPGPIWHGGRKGESLLLAGSYRNSLELAATWSCLTVAFPSISTGAY
GYPVDKAALVAVSTILDFLPTHPEMNITMVCWTDEDKAAYEKAYKKVLKDREKKEPHRYD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctcaatcatcaaaggggacatcacccaccagagcgtcgatgccatcgtcaat
gcagcgaatacccggttgcttgggggcagcggggtagatggagccatacatgccgccgcg
ggtccccagttgcttgaagaatgccgtaccttgggaggctgtgagacaggcaaggctaag
attaccgacggctacctgcttccggcacgccatgtcatccatactcccggccccatatgg
catggaggcaggaaaggtgagagcctccttcttgccgggagctatcgcaacagtttggag
cttgctgccacatggagctgcttgaccgtagcattcccctccatcagtacaggtgcttat
gggtatcctgtggacaaggcagcgctagtcgcggtttccacaattcttgacttcctgccg
acgcatcctgaaatgaacatcaccatggtttgctggacggatgaggataaggcggcatac
gaaaaggcatacaagaaagtgctgaaggacagggaaaagaaggaacctcatcgttacgac
taa

DBGET integrated database retrieval system