KEGG   Sphaerochaeta coccoides: Spico_0138Help
Entry
Spico_0138        CDS       T01469                                 

Definition
(GenBank) PspC domain protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspC Complex1_LYR_2
Motif
Other DBs
NCBI-ProteinID: AEC01376
UniProt: F4GJV1
Position
complement(160327..160761)
Genome map
AA seq 144 aa AA seqDB search
MATHRLYRSRYGEVFGVCKGLADWRELPVRTVRLICILIMVFSGFFPFALIYFIAALILP
LNPYEERDRSSRTAFRDKRAKERDYTKEYTSSWREVEEEEDPAPSDKEEKLRKRYEDLKT
RVEEMEDRMFDKEKAWDDKFQERM
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacatcgtttatatcgttcccgctatggcgaggtattcggagtctgcaaaggt
cttgcggactggagggaactgcctgtcagaactgtccgcctcatctgcatcctcatcatg
gtcttctccggtttctttccctttgccctcatttacttcattgccgcgttgatactgccg
ctcaacccctatgaggaaagggaccgttcatcacggaccgcattcagggacaagcgggca
aaagagagagattacacaaaagagtacacatcatcctggcgtgaagtcgaggaggaggaa
gatcctgctccctcagacaaggaagaaaagctccgcaagcgttatgaggacttgaagacg
cgggtagaggaaatggaagacaggatgttcgacaaggaaaaagcctgggacgacaagttc
caggaaaggatgtaa

DBGET integrated database retrieval system