KEGG   Sphaerochaeta coccoides: Spico_0139Help
Entry
Spico_0139        CDS       T01469                                 

Definition
(GenBank) hypothetical protein
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEC01377
UniProt: F4GJV2
Position
complement(160786..161157)
Genome map
AA seq 123 aa AA seqDB search
MWNAVFAIPIVAIVFGITSDIIKKISNNRLKAKQLEFLLREKELEAGVAPGTYSRMKGSR
RTKGYSFQESTGFQEFKGSGTHQSRQDLEKGIEDLLKRVENLDTVLAEKNAAEKKNGHKT
DLH
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgcagttttcgccatacctatcgtagcaattgtctttgggattacctctgat
atcataaaaaaaatctccaacaaccgcctcaaggcaaaacaactggagtttctcctcagg
gagaaagagcttgaagcaggcgttgctcctgggacatattcccgcatgaaaggaagccgc
cggactaagggatattctttccaggaatccacaggtttccaggaatttaaaggctccggt
acacaccagagccgccaggatcttgagaaaggcatagaagatttattgaaacgagtggag
aacctggatactgttctcgcggaaaagaatgccgcggaaaagaaaaacggccataaaacc
gaccttcattaa

DBGET integrated database retrieval system