KEGG   Sphaerochaeta coccoides: Spico_0141Help
Entry
Spico_0141        CDS       T01469                                 

Definition
(GenBank) Sigma 54 interacting domain protein
  KO
K03974  psp operon transcriptional activator
Organism
scc  Sphaerochaeta coccoides
Brite
KEGG Orthology (KO) [BR:scc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:scc03000]
    Spico_0141
Transcription factors [BR:scc03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Spico_0141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 Mg_chelatase HTH_8 AAA_5 HTH_28 AAA_22 ATPase
Motif
Other DBs
NCBI-ProteinID: AEC01379
UniProt: F4GJV4
Position
162091..163200
Genome map
AA seq 369 aa AA seqDB search
MDTVQARMPTQPLGESEVFLEFQEKASRAAMVERSVLIVGERGSGKEIAALRLHYQSPRW
EKPVVTVNCAALPPSLIESELFGYEQGAFTGAQKMRKGRFEEADGGTLFLDEIGLIPLEV
QEKILRVVEYGTFERVGSSRTHEVDVRIIGATNADLPQLCREGKFKEDLLDRLSFEVLFL
PPLREREGDILLLAHFFAAKMALECGREDIPVFSAEVEEALMTYSWPGNVRELKNVVERA
VYRIDGKLITSIQFNPFENPFTRKGIGFHDGHTGDESLPASVAGEDEVSHVPVPSDAPTF
MPLLASSLKNSENLDLSSFEDVKRDMDVLFLERALEVAGDNQKTAASLLGLTYDQFRGLY
RKYRKKGSA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggatacagtgcaggcacgcatgcccacgcaacccttgggggaaagcgaagttttcctg
gaatttcaggaaaaagcgagccgggctgcaatggtcgagagaagcgtgctcattgtcggg
gagcgtgggtcaggcaaggaaatagccgccctgcgcttgcactaccagtctccgcgctgg
gaaaaacccgtggtgacggtgaactgtgccgctttgcctccatccctgattgaaagtgag
ctgttcggctatgagcagggggctttcaccggggcacagaagatgcggaaaggccgcttt
gaggaagctgacggcggtactcttttccttgacgagataggattgattccgctggaagtc
caggaaaagattctcagggtagtggaatacggcacgttcgagcgtgtcggctcatctcgt
acccatgaggtggatgtgcgtatcataggagcgaccaatgccgatcttccccagctctgt
cgtgaaggaaagttcaaggaagacttgctggaccgcttgtcttttgaagtcctgttcctg
cctccgttgcgggaaagagagggcgatatcctgcttcttgcgcatttttttgccgcgaag
atggctctggaatgcggccgggaggacatacccgtcttttctgcggaagttgaggaagcc
ttgatgacatattcttggccgggcaatgtccgtgagttgaagaacgtagtggaacgggca
gtctatcgcatcgatggcaagctcatcacatccattcagttcaacccctttgagaatcca
tttacacgaaagggcatcggattccatgatgggcatacaggggatgaatccctgcctgct
tctgtcgccggggaggatgaagtctctcatgttccggtgccatccgacgcgccgaccttc
atgccgctcttggcatcgtccctgaaaaattctgaaaaccttgatttgtcttcctttgaa
gacgtgaagcgtgatatggatgttcttttccttgagcgggcgctggaagttgcgggagac
aatcagaagaccgcggcaagcctgctgggattgacatatgatcagttccgtgggttgtac
cggaaatacaggaagaaaggttctgcgtaa

DBGET integrated database retrieval system