KEGG   Sphaerochaeta coccoides: Spico_0147Help
Entry
Spico_0147        CDS       T01469                                 

Definition
(GenBank) NGG1p interacting factor 3 protein, NIF3
Organism
scc  Sphaerochaeta coccoides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIF3
Motif
Other DBs
NCBI-ProteinID: AEC01385
UniProt: F4GJW0
Position
168199..168960
Genome map
AA seq 253 aa AA seqDB search
MKLTEMVKVLDAELDIASFAAVDIALNGLQVGSHEKEVKKVALAVDASLATFKAAASWGA
DAIMVHHGLFWGQPLALTGAHHDRVKFLMDNDIALYAAHLPLDAHPTLGNNACIARKLGI
DRPVPFGLYKGVRIGFKGILATPVEADEIAARLGYDESTGLKILTFGPRKIRSIGIVSGG
AADDVHDALADGLDAFLTGEALHQVYHDCMENGITMICGGHYATETLGVQAVGHFLAEGY
GVDASFIAIPTGL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacagagatggtgaaagtactcgatgcagagcttgatatcgcttcctttgcg
gctgtggacatagccctgaacggattgcaggtcggctcccatgagaaggaagtgaaaaag
gtcgccttggccgtggatgcttcgctggctactttcaaagccgctgcatcttggggcgcg
gatgccatcatggtgcatcatggcttgttttggggacagccgctggccctgaccggggct
catcatgacagggtgaagttccttatggacaacgacattgccctgtatgccgcgcatctt
cctttggacgctcatccgacgctgggaaacaatgcctgcattgcccggaagttgggaata
gaccggcctgtgccgttcggcctctacaaaggcgtgcgcattggcttcaaggggattctg
gcaactcctgtggaagcggatgaaatagccgcccgactgggatatgatgaaagcaccgga
ttgaagatacttactttcgggccacggaaaatacggtcgattggaattgtcagcggtggc
gcggcggatgatgtgcatgatgccttggctgatggattggatgcctttctcaccggagaa
gcgcttcatcaggtataccacgattgcatggaaaatggcattaccatgatttgcgggggg
cattatgctacggagaccttgggcgtacaggctgtcggtcattttcttgccgaaggctat
ggtgtggatgcgagcttcattgccatccccaccgggctgtag

DBGET integrated database retrieval system