KEGG   Sphaerochaeta coccoides: Spico_0968Help
Entry
Spico_0968        CDS       T01469                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00010  Glycolysis / Gluconeogenesis
scc00052  Galactose metabolism
scc01100  Metabolic pathways
scc01110  Biosynthesis of secondary metabolites
scc01120  Microbial metabolism in diverse environments
scc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spico_0968
   00052 Galactose metabolism
    Spico_0968
Enzymes [BR:scc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Spico_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim HCV_NS2
Motif
Other DBs
NCBI-ProteinID: AEC02192
UniProt: F4GIQ8
Position
complement(1118858..1119934)
Genome map
AA seq 358 aa AA seqDB search
MTVLSMPKGRGRMITQRRFGTDPLGQAVTLFTLTAGDYSADIITYGATLVAFRTPDRAGR
INDIVLGFDTLDGYLPKNQYIGKTVGRFANRIAEGTFTIDGETFHARKNEPTAVLHGGEE
GISNYTWHAETYEADGAPGVMLSHVSKDGASGFPGKCTVSVSYLLQDDGALFIDYDASSS
KPTPISLTNHSYFNLAGAASGSILNHVLRISCNRYLQVDANLIPHESPASVEGTAFDFRS
GKPIGRDMGGTGIAGYDHCLVMEEKEADGLREFAHVVEPTSGRTLTCYTTLPAVQFYTAN
HLDGTIKGKGGLAYGRHAGFCLETQEYPDAPNHPDYPDCILRPGTVWRHTTVYDAGVI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacagtattatcgatgccaaaggggaggggaaggatgattacgcagagacggttcgga
acagatccattgggacaggcggtcaccctgttcacgctaactgccggagactactccgct
gatatcatcacctacggggcgacgctcgtggcgttccgcactccggatcgggctggcagg
attaatgacatcgtactcggttttgatacacttgacgggtatctccccaagaaccagtat
atcggaaagacggtcgggcgttttgcaaaccggattgccgaaggaaccttcactatcgac
ggtgagacatttcatgcgcggaagaatgaaccgacagctgtcctgcatggtggagaagaa
ggcatcagtaattatacatggcatgcggaaacctatgaggcggatggagcccccggcgtc
atgttgagtcatgtcagcaaggacggtgccagcggattccccggtaagtgtaccgtctcc
gtgagctatcttcttcaagatgatggcgctctgttcattgactatgatgcatcatcatca
aaaccgacgccgattagcctgaccaaccattcttatttcaatcttgcgggtgctgccagc
ggttctatcctgaatcatgtactccggatttcctgcaatcgttatctccaggtcgatgcc
aaccttattccgcatgaatctccggcttctgtcgaagggacagcctttgatttccgttcg
ggcaagcctatcggacgcgacatgggtggtacggggattgcaggatatgatcattgcctt
gtcatggaagaaaaggaagccgatggtctgcgtgaattcgcccatgtggtcgaaccaaca
agcggaaggacgctcacatgctatacgacgcttcccgccgtgcaattctacacagccaac
catctggacgggacaatcaaagggaagggagggctggcatatggccgacatgccggtttc
tgtctggaaacccaagagtatccggacgcgccgaaccatccggattatccggactgcata
ctccgtcccggtacggtatggcgtcataccaccgtatatgacgcgggggtgatctga

DBGET integrated database retrieval system