KEGG   Sphaerochaeta coccoides: Spico_0976Help
Entry
Spico_0976        CDS       T01469                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00900  Terpenoid backbone biosynthesis
scc01100  Metabolic pathways
scc01110  Biosynthesis of secondary metabolites
scc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spico_0976
Enzymes [BR:scc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Spico_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEC02200
UniProt: F4GJD5
Position
complement(1128383..1129336)
Genome map
AA seq 317 aa AA seqDB search
MESRAGRLDSRLISCYRAFMTAIHPSYAKVNLHLEVGAKGFDGYHDISTVFHLVSLHDDV
SVELRLSDKFSCSVTGLESICRPGEDSLHRAAEAWCHATGRPLSLDIRVTKRIPSGAGLG
GGSSNAATLLSILDAAAPGGYSMGRKRLMELGTTLGSDVPFFLSGYTAAIGEGRGERLTP
LKAVRDAHALIVMPPFSVSTPHAYLSLDTLRGGDSVSLHRFSFMAGDSSRLSSLLEDDVT
KWMFSNDFRLTCGHEDVYDALEALGRKVPGVFSSLTGSGAAWVFISRKLLSLKDIQTQIS
RLFGVRFVMFSAILLFS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccgtgccggcaggctcgacagccggttaatctcctgctatcgtgcttttatg
acggcaattcatccatcatatgccaaagtgaaccttcatcttgaagtcggggcaaaaggc
ttcgacggctatcatgacatctccacggtctttcatcttgtcagtctccatgacgatgtt
tcggtggaattaagattgtctgataagttctcttgttccgtgaccggacttgaaagcata
tgccgtccgggtgaggactctctccatcgggcggcggaagcttggtgccacgccacggga
cgcccgctttccttggacatccgtgtcaccaaacgcataccttccggcgccgggctaggc
ggaggctcgtcaaacgcggcaacgctcctttccattctggatgccgctgctccgggagga
tactccatgggaagaaaacgactgatggagctggggactacattgggaagcgatgtgcca
ttctttctttcgggatacactgcggccatcggggaggggagaggcgaaaggctcacgccg
cttaaggcagtccgcgatgcccatgccttgattgtcatgccgccgttttccgtttctacg
cctcatgcatacctaagtctggacactctcagggggggagattccgtctctttacaccgg
ttttcatttatggcaggggattcatcacgtctgtcatccctgcttgaagatgatgtgacc
aaatggatgttttccaatgacttccgcttgacttgtggtcatgaggatgtctatgacgcg
cttgaagcccttggacggaaagtccccggcgtgttttcgtctttgacagggagtggagcc
gcatgggtgttcatcagcaggaagcttttgtccctgaaggatatccaaactcagatttca
agactgtttggggtgagatttgttatgttttctgcaattttgttgttttcttga

DBGET integrated database retrieval system