KEGG   Sphaerochaeta coccoides: Spico_1841Help
Entry
Spico_1841        CDS       T01469                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
scc  Sphaerochaeta coccoides
Pathway
scc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:scc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spico_1841
DNA repair and recombination proteins [BR:scc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Spico_1841
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Spico_1841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH HHH_8
Motif
Other DBs
NCBI-ProteinID: AEC03039
UniProt: F4GLZ8
Position
2191594..2192184
Genome map
AA seq 196 aa AA seqDB search
MNTLDNLIQALSRLPGIGPKSAARIGYHLIKTNPQYNKELAKSIGTIQDVVFPCPVCGSY
TEISPCRFCSDSSRDRELLCVVEQPQDVVTISTSGSYNGLYHVLGGAISPLDGIGPEDLS
FDSLMRRISEGSFQEVIIATNPTEEGDTTAMYIRHLMKDFPDIILTRLASGLPIGGDLEY
ADRLTLARSLRGRIKF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctggacaatctcatccaagcattgagccgtttgcccggcatcggccccaag
agcgcagcccgcatcggctaccacctgataaagacaaatccccagtataacaaggaactg
gcaaaaagcatcgggactatccaggatgtcgttttcccttgtcctgtctgcggcagctac
acggagatatctccctgccggttctgctctgactcatcgcgggacagagaacttctttgc
gtggtggaacaaccgcaggatgtagtgacgatcagcacgtccggctcatacaacggcctg
taccatgtccttggcggggcaatcagtcccttggatggcataggaccggaagacttgagt
ttcgattccttgatgcgccgcatttccgaaggttccttccaagaggtcatcatagccacg
aatcctaccgaggaaggggatactacggccatgtatatccgtcacctgatgaaagatttt
cctgatatcatcctgacacggttggcttccggactgccaatcggcggagacttggaatat
gccgaccgcctcactctcgcccgttccctccgcggacgcatcaagttctga

DBGET integrated database retrieval system