KEGG   Treponema caldarium: Spica_2318Help
Entry
Spica_2318        CDS       T01573                                 

Definition
(GenBank) Monosaccharide-transporting ATPase
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
scd  Treponema caldarium
Pathway
scd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:scd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spica_2318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scd02000]
    Spica_2318
Enzymes [BR:scd01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Spica_2318
Transporters [BR:scd02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Spica_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_13 AAA_29 RsgA_GTPase AAA_30 AAA_23 SMC_N SbcCD_C AAA_22 AAA_16 AAA_27 AAA_25
Motif
Other DBs
NCBI-ProteinID: AEJ20429
UniProt: F8F3A3
Position
complement(2592665..2594176)
Genome map
AA seq 503 aa AA seqDB search
MQSEKILEMKGICKSFPGVMALQNVDFTLRKGEVHALMGENGAGKSTLVKIITGVYEKDA
GSMFVEGESVHFRSPEEAQNSGIGTVYQEISLCPNLSVAENMFIGRGHSSLVNWKRMNEQ
AAHLLNSLEIPARPTQELSSCSIAVQQMIAIARAVDMDCKILILDEPTSSLDEDEVIKLF
KLMRELKSRGVGIIFITHFLDQVYEISDRITVLRNGNLIGEYEASSLSQLELVSKMMGKA
LDDVEHMEKPRIMKHEQDAPVFEAKSLRSVSDIQPFDFKIWKGEVNGFAGLLGSGRSESV
RAIYAADKVTGGETMMNGKQVNIKEPIHAMKLGIGYLPEDRKGEGILADLSVRDNLILAF
QVLKGFFKPLSKKQAETFTREFIKKLSIKTPSPNTPIKSLSGGNQQKVILARWLLTHPQY
LILDEPTRGIDVGTKVEIQKLVLQLAEEGVSVTFISSEIEEMLRTCSRLIVMRDRQIVGE
LTGTNVTQADVMHVIAGGGYEHA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtcagaaaaaatactcgagatgaaggggatatgcaaatcctttccaggagtcatg
gctctgcaaaatgtagattttacccttagaaagggtgaagtacatgctcttatgggcgag
aatggggcaggaaaatctacactggttaaaattataactggcgtctatgaaaaagacgct
ggaagtatgtttgtagaaggggagtctgtgcactttcgttcccctgaagaagcgcaaaat
agcggcattggaacggtctatcaggaaatcagtctctgtccaaatcttagcgtcgctgaa
aatatgtttattggccgtgggcattcatccttagttaattggaaacgtatgaatgaacaa
gcggctcacctgcttaactctctcgaaattcctgcccggccaacccaggagctatcgagc
tgttccattgcggttcagcaaatgattgcgattgcccgggctgttgatatggattgtaag
attctcattctcgatgaaccaacctcttcgcttgatgaagatgaggtgatcaagcttttt
aagttgatgagagaacttaaatcgagaggggtaggtattatttttatcacccatttcctt
gatcaggtctatgaaattagtgatcggattaccgtattgcgtaatggaaacttgatcggt
gaatatgaagcctcttccctttcccagttggagcttgtttccaaaatgatgggtaaggct
ctggatgatgtcgaacacatggaaaaaccaagaataatgaaacatgagcaggatgcacca
gtctttgaagccaaaagcctcaggagtgtttctgatatacaaccctttgactttaaaata
tggaaaggtgaagtgaatggttttgccggtttgcttggttcaggacgaagtgagagtgtt
cgggcaatttatgccgcagataaagtaaccggcggcgaaaccatgatgaatggtaaacag
gtaaatataaaagaacctatacatgcaatgaaactgggaataggctatctgccggaagat
agaaagggtgaaggcattcttgcagacctttcggttcgggataatcttattctggccttt
caggtactcaaaggtttctttaaaccgctatcgaaaaaacaggccgaaacatttacccgg
gaatttattaaaaagctttcaattaaaacgccttcacccaatacgccgataaaatccctt
tcaggcggaaatcagcaaaaggtgatacttgcacgatggctccttactcatccccagtat
cttattcttgatgaacctacccggggtatcgatgtaggaacgaaagtggagattcagaaa
cttgtattgcaactggctgaagagggggtcagtgtgacctttatatcatcagaaatagaa
gaaatgctcagaacctgttcacgactcattgtcatgagagatcgtcaaattgttggagaa
ctgaccggtaccaatgtaacccaggccgatgtcatgcatgtcatagcaggaggtgggtat
gagcatgcttaa

DBGET integrated database retrieval system