KEGG   Treponema caldarium: Spica_2438Help
Entry
Spica_2438        CDS       T01573                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
scd  Treponema caldarium
Pathway
scd00340  Histidine metabolism
scd01100  Metabolic pathways
scd01110  Biosynthesis of secondary metabolites
scd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Spica_2438
Enzymes [BR:scd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Spica_2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEJ20547
UniProt: F8F4A0
Position
2744612..2746009
Genome map
AA seq 465 aa AA seqDB search
MTILKAKDFDAYWNSLHGGRPLPRGDAAAAGPAHLASSPAAAAPVAASPSPEALSPSAAT
ATDTAVLAIIEAVRSGGDRALRDLAARFDRSSPERLEVPMTAARRALEELEATDASLATA
LRLAADHIRVFAELQKKQFTDFEVKLEPGLFTGQRCIPVERAAVYVPAGRFPLISTVLMG
VIPAKVAGVDELIILSPPLEDGLPDRRILAAAALAGADRIFAVGGAQAVAAAAFGTESVP
RCDVIVGPGNKYVAAAKRLLFGQVGIDFVAGPTDVLIIADGTASADLIAADMLAQAEHDP
DARARVLVPSEALAQAVQADLVRRLSKLGTADTARASLDAGGLIIIYETLDEAIQIANTI
APEHLELHLAEPETIAGRLRNYGSLFIGHLAAEVLGDYSAGINHTLPTSGTARFTGGLSV
RHFIKTVTSLRCTPGSGFETSRKAAAIIARAEGLDGHRQSAESRG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaccatactgaaagccaaggattttgatgcatactggaactcactccatgggggcaga
cctttgccccggggagacgccgcggcggctggccccgcacacctcgcatccagccctgct
gccgcggcccctgttgccgcgagcccctcgcctgaggccctaagcccatcagcggccaca
gcgaccgacacagcggtcctcgccatcatcgaagctgtccgttccggcggggaccgggcc
ctgcgggacctggcggcccgctttgaccgctcaagcccagaacggctggaagttcccatg
actgcggcccgccgggcccttgaggaactggaagcgaccgatgcgagcctcgccacagcc
ctgaggctcgccgctgaccacatcagggtttttgcagaactgcagaaaaagcagtttacc
gactttgaggtgaaacttgagccggggcttttcacgggtcagcggtgcattccggtggaa
cgggctgcggtctatgtcccggcgggccgcttccccctcatttctacggtgctcatgggg
gtcatccccgcaaaggtagccggtgtggatgagcttatcatcctgtcaccgcctcttgaa
gatggccttccggaccggcgcatcctggccgcagcggcattggccggggcagaccggata
tttgccgtcggcggtgcccaggctgttgcggcagccgcctttggaaccgaatcggtcccc
cgctgtgatgtgatcgtggggccgggaaataaatatgtggccgccgcaaagcggctcctc
tttggccaggtcggcatagactttgtggcgggtcccacggatgtgctcatcatagccgat
ggaacggccagcgcggacctcatcgccgcggatatgctggctcaggcagaacatgatccg
gacgcccgcgcccgggtcctagtccccagcgaagcgctggcccaggccgtgcaggccgac
ctggtgcggcggctgagcaagctgggcaccgccgacaccgcccgggcatccctcgatgcc
ggggggcttatcatcatctatgaaaccctggacgaagccatacagattgctaacaccatt
gcaccggaacacctggaactgcacctggcagagccggagaccattgccggcaggctcagg
aattatggctccctctttatagggcacctggcggcggaagtgctgggcgattattcagca
gggattaaccatacccttccaacttcaggaacagcccgctttaccggcggcctctcggtc
cggcacttcattaaaaccgtcaccagcctccgctgtacgccaggttccggctttgagaca
agccgaaaggccgctgccataatcgcccgtgctgaagggctcgacggccaccggcaaagc
gctgagagcaggggatag

DBGET integrated database retrieval system