KEGG   Saccharomyces cerevisiae (budding yeast): YBR019C
Entry
YBR019C           CDS       T00005                                 
Symbol
GAL10
Name
(RefSeq) bifunctional UDP-glucose 4-epimerase/aldose 1-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00052  Galactose metabolism
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01250  Biosynthesis of nucleotide sugars
Module
sce_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBR019C (GAL10)
   00052 Galactose metabolism
    YBR019C (GAL10)
   00520 Amino sugar and nucleotide sugar metabolism
    YBR019C (GAL10)
Enzymes [BR:sce01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     YBR019C (GAL10)
    5.1.3.3  aldose 1-epimerase
     YBR019C (GAL10)
SSDB
Motif
Pfam: Aldose_epim GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind KR adh_short NAD_binding_4 NAD_binding_10
Other DBs
NCBI-GeneID: 852307
NCBI-ProteinID: NP_009575
SGD: S000000223
UniProt: P04397
Structure
Position
II:complement(276253..278352)
AA seq 699 aa
MTAQLQSESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTK
HHIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLE
LMQQYNVSKFVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGHTKYAIENILNDLYNS
DKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSR
DGTPIRDYIHVVDLAKGHIAALQYLEAYNENEGLCREWNLGSGKGSTVFEVYHAFCKASG
IDLPYKVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWTTENPFGYQLRGV
EARFSAEDMRYDARFVTIGAGTRFQATFANLGASIVDLKVNGQSVVLGYENEEGYLNPDS
AYIGATIGRYANRISKGKFSLCNKDYQLTVNNGVNANHSSIGSFHRKRFLGPIIQNPSKD
VFTAEYMLIDNEKDTEFPGDLLVTIQYTVNVAQKSLEMVYKGKLTAGEATPINLTNHSYF
NLNKPYGDTIEGTEIMVRSKKSVDVDKNMIPTGNIVDREIATFNSTKPTVLGPKNPQFDC
CFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYTGDFLSAGYEARQ
GFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgacagctcagttacaaagtgaaagtacttctaaaattgttttggttacaggtggtgct
ggatacattggttcacacactgtggtagagctaattgagaatggatatgactgtgttgtt
gctgataacctgtcgaattcaacttatgattctgtagccaggttagaggtcttgaccaag
catcacattcccttctatgaggttgatttgtgtgaccgaaaaggtctggaaaaggttttc
aaagaatataaaattgattcggtaattcactttgctggtttaaaggctgtaggtgaatct
acacaaatcccgctgagatactatcacaataacattttgggaactgtcgttttattagag
ttaatgcaacaatacaacgtttccaaatttgttttttcatcttctgctactgtctatggt
gatgctacgagattcccaaatatgattcctatcccagaagaatgtcccttagggcctact
aatccgtatggtcatacgaaatacgccattgagaatatcttgaatgatctttacaatagc
gacaaaaaaagttggaagtttgctatcttgcgttattttaacccaattggcgcacatccc
tctggattaatcggagaagatccgctaggtataccaaacaatttgttgccatatatggct
caagtagctgttggtaggcgcgagaagctttacatcttcggagacgattatgattccaga
gatggtaccccgatcagggattatatccacgtagttgatctagcaaaaggtcatattgca
gccctgcaatacctagaggcctacaatgaaaatgaaggtttgtgtcgtgagtggaacttg
ggttccggtaaaggttctacagtttttgaagtttatcatgcattctgcaaagcttctggt
attgatcttccatacaaagttacgggcagaagagcaggtgatgttttgaacttgacggct
aaaccagatagggccaaacgcgaactgaaatggcagaccgagttgcaggttgaagactcc
tgcaaggatttatggaaatggactactgagaatccttttggttaccagttaaggggtgtc
gaggccagattttccgctgaagatatgcgttatgacgcaagatttgtgactattggtgcc
ggcaccagatttcaagccacgtttgccaatttgggcgccagcattgttgacctgaaagtg
aacggacaatcagttgttcttggctatgaaaatgaggaagggtatttgaatcctgatagt
gcttatataggcgccacgatcggcaggtatgctaatcgtatttcgaagggtaagtttagt
ttatgcaacaaagactatcagttaaccgttaataacggcgttaatgcgaatcatagtagt
atcggttctttccacagaaaaagatttttgggacccatcattcaaaatccttcaaaggat
gtttttaccgccgagtacatgctgatagataatgagaaggacaccgaatttccaggtgat
ctattggtaaccatacagtatactgtgaacgttgcccaaaaaagtttggaaatggtatat
aaaggtaaattgactgctggtgaagcgacgccaataaatttaacaaatcatagttatttc
aatctgaacaagccatatggagacactattgagggtacggagattatggtgcgttcaaaa
aaatctgttgatgtcgacaaaaacatgattcctacgggtaatatcgtcgatagagaaatt
gctacctttaactctacaaagccaacggtcttaggccccaaaaatccccagtttgattgt
tgttttgtggtggatgaaaatgctaagccaagtcaaatcaatactctaaacaatgaattg
acgcttattgtcaaggcttttcatcccgattccaatattacattagaagttttaagtaca
gagccaacttatcaattttataccggtgatttcttgtctgctggttacgaagcaagacaa
ggttttgcaattgagcctggtagatacattgatgctatcaatcaagagaactggaaagat
tgtgtaaccttgaaaaacggtgaaacttacgggtccaagattgtctacagattttcctga

DBGET integrated database retrieval system